KEGG   Martelella endophytica: TM49_02230Help
Entry
TM49_02230        CDS       T03801                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mey  Martelella endophytica
Pathway
mey00564  Glycerophospholipid metabolism
mey01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mey00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TM49_02230
Enzymes [BR:mey01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     TM49_02230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox FAD_binding_3 Pyr_redox_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AJY44764
UniProt: A0A0D5LKN5
LinkDB All DBs
Position
483066..484583
Genome map
AA seq 505 aa AA seqDB search
MTGETPKAPVDLFVIGGGVNGVGVARDAVGRGLSVTLAEMHDLASATSSASTKLYHGGLR
YLEYYEFRLVREALIEREVLLKAMPHISWPMRFVLPHHKGLRPWWLLRLGLFLYDHLGGR
KILPATRSLDLARDVAGTPLKSEYRRAFEYSDCWVQDARLVSLMARDASERGATIMTRTR
VTGAEQVSAEDGNTLWKISLEDETGPRAPVFARALVNAGGPWVADLLKGTLGIETKEKVR
LVRGSHIVTKKLYDHDRCYFFQGTDGRIIFAIPYEQDFTLIGTTDQDHHSSSEHVECTPE
EADYLCRFASDYFRQPVTRDDIVWTYSGVRPLYDDGASSATAATRDYVLSLREDGAPLLS
VFGGKITTHRKLAEAVFHKLSHHFPQAGADWTAGSTLPGGDFPVTDAARLPEKLKADYPF
LDFAMALRLFRTYGSECWTLLGDARALADLGRDFGGGLTEREVCWLVEKEFARSAEDIVF
RRTKLGLRMSPEEIAALDDWLQNAG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcgagaccccgaaagcgcctgtggacctcttcgtcatcggcggtggcgtcaat
ggcgtcggagtggcacgcgatgccgtcggccgcgggctttcggtgacgctggccgaaatg
cacgatctggcttccgccacgtcttcagcttccaccaagctctatcatggcggcctgcgc
tacctcgaatattacgagttccggctggtgcgcgaggcgctgatcgagcgcgaggtgctg
ctaaaggcgatgccgcatatttcttggccgatgcgcttcgtgctgccgcaccacaagggg
ctgaggccatggtggcttctaaggctgggcctgttcctctacgaccatctcggcggccgc
aagatcctgccggcaacgaggtcgctggatcttgcacgagacgttgccggcacgccgctg
aagagcgaataccgccgcgccttcgaatattccgattgctgggtgcaggacgcacgcctc
gtcagcctgatggcgcgcgatgcgagcgagcgcggcgccaccatcatgacccgcaccagg
gtgacgggcgccgagcaagtcagcgccgaagatggcaacaccctctggaaaatctcgctt
gaggacgagaccgggccgcgtgcccccgtcttcgctcgtgcgctggtcaatgccggtggc
ccctgggtcgccgatctgctgaagggcacgctcggcatcgaaacgaaggaaaaggtccgc
ctcgttcgcggcagccacatcgtcacaaagaaactctacgaccacgaccgctgctatttc
ttccagggcacggacggccggatcatcttcgcaattccctatgaacaggatttcaccctg
atcggcaccaccgatcaggaccatcacagctcgagcgagcatgtggaatgcacaccggag
gaagcagactatctctgccgcttcgcctccgactatttccgccagcccgtcactcgcgat
gacatcgtgtggacctattcaggggtgcgcccgctttatgatgacggcgcctcgtcggcg
acggcagcgacgcgcgattacgtgctttcgctgagggaagacggcgcgccgctgctcagc
gttttcggcggaaagatcaccacccaccgcaaacttgcggaagcggttttccacaagttg
tcccatcattttccacaggccggcgctgactggacggcgggctcgacgctgccgggtggt
gactttccggtgacagatgcggcaaggcttccggagaagctgaaggcagattaccccttc
ctcgattttgccatggccttgcgtctcttccgcacctatggcagcgagtgctggacgctt
cttggcgacgcccgcgcgcttgcggatctcggccgcgacttcggcggcggccttaccgag
cgcgaggtgtgctggctcgtcgagaaggaattcgcccgctctgcggaggatatcgtcttc
cgccgcaccaagctcggcctcaggatgagcccggaggaaatcgccgcgctcgacgactgg
cttcaaaacgccggctga

DBGET integrated database retrieval system