KEGG   Martelella endophytica: TM49_02805Help
Entry
TM49_02805        CDS       T03801                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mey  Martelella endophytica
Pathway
mey00640  Propanoate metabolism
mey00650  Butanoate metabolism
mey01100  Metabolic pathways
mey01120  Microbial metabolism in diverse environments
Module
mey_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    TM49_02805
   00650 Butanoate metabolism
    TM49_02805
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TM49_02805
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TM49_02805
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mey01007]
    TM49_02805
Enzymes [BR:mey01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     TM49_02805
Amino acid related enzymes [BR:mey01007]
 Aminotransferase (transaminase)
  Class III
   TM49_02805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 MmgE_PrpD
Motif
Other DBs
NCBI-ProteinID: AJY44864
UniProt: A0A0D5LL10
LinkDB All DBs
Position
613021..614301
Genome map
AA seq 426 aa AA seqDB search
MLNSDIATRRDAAISRGVGMQTQIYVDRAKNAEVFDVEGRRYIDFAAGIAVVNTGHCHPK
VMAAVEDQLKRFTHTCHQVLPYEHYIRLAERLNAAVPGDFDKKTVFVTTGAEAVENAVKA
ARAATGRSAVIAFNGGFHGRTFMTLSLTGKVAPYKTGFGPMMPDVYHIPYPAELHETSAE
DSLKALKSLFKTDLDPARVAAIIIEPVQGEGGFYPAPAELMRAIRAICDAHGIVMIADEV
QTGIGRTGKLFAMEAYDVAADLTTIAKGIGGGLPLAAVTGRATMMDAAGPGGLGGTYGGN
PLSIAAANAVLDVIEEEDLLNRASRLGSYLKQRLEAIRAVTPEIAEIRGPGFMVAAEFMT
EDGAPNPDMTNAVRLEAQSRGLILLTCGVYGNVIRFLAPLTIEEEVLAEGVDILEASIAA
VKEKQA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgttgaattcggatatcgccacacggcgggatgccgccatttcacgcggcgtcggcatg
cagacgcagatctatgtcgaccgggccaaaaacgcggaagtcttcgacgtcgagggccgg
cgttatatcgactttgccgccggcatcgccgtggtcaacaccggccattgccacccgaag
gtcatggcagcggtggaagatcagttgaagcgcttcacccatacctgccatcaagtgctc
ccctacgagcactatatccgccttgccgagcggctgaatgccgccgttcccggcgatttc
gacaagaagactgtcttcgtcaccaccggcgccgaggctgtcgagaatgcggtaaaggcc
gcgcgcgcggccaccggccgttcggccgtgatcgccttcaatggcggctttcatggccgc
accttcatgaccctgtcgctgaccggcaaggtcgcaccctacaagaccggcttcgggccg
atgatgccggatgtctaccacattccctatcctgccgaactgcacgagacgtcggctgaa
gacagcctgaaggcgctgaagtccctgttcaagaccgatctcgatccggcgcgcgtcgcc
gccatcatcatcgagccggtacagggcgaaggcggcttctatccggcccccgccgaactg
atgcgcgccatccgcgccatctgcgacgcgcacggcatcgtcatgatcgccgacgaagtg
cagaccggcatcggccgcaccggcaagctcttcgccatggaagcctatgatgtcgccgcc
gacctgacgacgatcgccaagggcattggcggcggcctgccgcttgccgccgtcaccgga
cgggcgacaatgatggatgcggccggccccggcgggctcggcggcacctatggcggcaac
ccgctgtcgatcgccgccgccaatgcggtgctggacgtgatcgaagaggaagacctcctg
aaccgcgccagccggctcggctcctacctcaagcagcggcttgaggcgatccgcgccgtg
acgcccgagattgccgagatccgtggcccgggcttcatggtcgctgccgagttcatgacg
gaagacggcgcgccgaacccggacatgaccaatgcggtgcggctggaagcccagagccgc
ggcctcatcctgctgacctgcggcgtttacggcaatgtcatccgcttcctcgccccgctg
acgatcgaggaagaggttctggcggaaggcgtcgacattctcgaggcatcgatcgccgcc
gtgaaggagaagcaggcatga

DBGET integrated database retrieval system