KEGG   Martelella endophytica: TM49_08305Help
Entry
TM49_08305        CDS       T03801                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mey  Martelella endophytica
Pathway
mey00240  Pyrimidine metabolism
mey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mey00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    TM49_08305
Enzymes [BR:mey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     TM49_08305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30
Motif
Other DBs
NCBI-ProteinID: AJY45682
UniProt: A0A0D5LPI7
LinkDB All DBs
Position
1820632..1821213
Genome map
AA seq 193 aa AA seqDB search
MAKLHFYYATMNAGKSTLLLQAAYNYRERGMHAVILLADLDDRAGKGIVSSRIGLTSEAV
TFGPDTDLFELAQSLNAEQAIDCLFVDETNFATAAHVWQLARVVDELDIPVMAYGLRSDF
RGELFPASRELFALADEVREVRTICHCGRKATMVVRLDAGGNALLEGPQIEVGGNERYVS
LCRKHWKEKTGRR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcttcatttctattacgccacgatgaatgccggtaagtcgacgctgctgctg
caggctgcctacaattaccgcgaacgcgggatgcatgcggttatcctgctggccgacctc
gacgatcgcgccggcaaggggattgtctcgtcgcgcatcggcttgacctcggaggcagtg
accttcgggccggataccgacctgttcgagcttgcgcagtctctcaatgccgagcaggca
atcgattgcctgtttgtcgacgagaccaatttcgcgacggcggcgcatgtctggcagctc
gcccgggtggttgacgagctcgacattccggtcatggcctatggcctgagatcggatttc
cgcggtgagctgtttccggcctcgcgtgagctttttgcgcttgccgacgaggttcgcgaa
gtccgcaccatctgccattgcggtcgcaaggccaccatggtggtgcgcctcgatgccggt
ggcaatgcgttgctcgaggggccgcagatcgaggtcggcggaaacgagcgctatgtatcg
ctttgccgcaagcactggaaagaaaagaccgggcggcgctga

DBGET integrated database retrieval system