KEGG   Martelella endophytica: TM49_14765Help
Entry
TM49_14765        CDS       T03801                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mey  Martelella endophytica
Pathway
mey00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mey00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    TM49_14765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mey02000]
    TM49_14765
Enzymes [BR:mey01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     TM49_14765
Transporters [BR:mey02000]
 Other Transporters
  Pores ion channels [TC:1]
   TM49_14765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AJY48242
UniProt: A0A0D5LWR0
LinkDB All DBs
Position
complement(3230739..3231365)
Genome map
AA seq 208 aa AA seqDB search
MVSRIEFYTNPQSRGRMARWMLEEVGADYETHILTYNGTMKEPAYLAINPMGKVPTIVHD
GKVITECAAICAYLADAFPDAGLAPPPAERAAYYRWLFFGAGPLEASVSNRALGLAVPPE
RERSIGYGNFAHVMKTLDRHLSESSYIAGEAFTAADVYVGSQILWGVQFGTVEDRPSFRA
YADRLSPRPAFIRANELDDDAAASGVSA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atcgtgagcaggatagagttttataccaacccgcaatcgcgcggacggatggcacgctgg
atgctggaggaagtgggggcggactacgagacccacatcctcacctataacggcacgatg
aaggaaccggcctatctggcgattaatcccatgggcaaggtgccgaccatcgtccacgac
ggcaaagtcatcaccgaatgcgcggcgatctgcgcctatctcgccgatgcgtttccagac
gccgggctcgcgccgccgccggcggagcgcgccgcctattatcgctggctcttcttcggc
gccggccctctggaggcctcggtcagcaaccgtgcgctcggcctcgccgtgcctccggag
cgggagcggtccatcggctacggcaatttcgctcatgtcatgaagacactcgacaggcac
ctgtcggaaagctcctacattgccggcgaagcctttaccgccgccgacgtctatgtcggc
tcgcagatcctgtggggcgtgcagttcgggacggtggaggaccgaccgtcattccgcgcc
tatgccgaccggctgagccctcgccctgcctttatccgcgccaacgagctggatgatgac
gcagccgcatcgggcgtgagcgcgtag

DBGET integrated database retrieval system