KEGG   Martelella endophytica: TM49_20630Help
Entry
TM49_20630        CDS       T03801                                 

Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
mey  Martelella endophytica
Pathway
mey00061  Fatty acid biosynthesis
mey01100  Metabolic pathways
mey01212  Fatty acid metabolism
Module
mey_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mey00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TM49_20630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mey01004]
    TM49_20630
Enzymes [BR:mey01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     TM49_20630
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     TM49_20630
Lipid biosynthesis proteins [BR:mey01004]
 Fatty acid synthase
  Component type
   TM49_20630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AJY47531
UniProt: A0A0D5LTZ7
LinkDB All DBs
Position
4425628..4426143
Genome map
AA seq 171 aa AA seqDB search
MSDRQTQFDYDDIIKCAEGELFGPGNAQLPLPPMLMVHRITEISETGGAFDKGFIRAEYD
VSPDDWYFPCHFKGNPIMPGCLGLDGMWQLTGFFLGWLGEEGRGMALSTGEVKFKGMVRP
SVKLLEYGIDFKRVMRGRLVLGTADGWLKADGETIYQATDLRVGLSKDKSA
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagacagacgcagttcgattacgacgacatcatcaaatgcgcggagggggag
cttttcgggccgggcaatgcgcaattgccgctgccgccgatgctgatggttcaccggatc
accgagatttccgaaaccggcggcgcattcgacaagggcttcatccgggccgaatatgat
gtcagccccgacgactggtattttccatgccacttcaagggcaacccgatcatgcccggc
tgcctcggtctcgatggcatgtggcagcttaccggtttcttcctcggctggctgggagaa
gaaggccgcggcatggccctgtcgaccggagaagtgaaattcaagggcatggtacgcccg
agcgtcaagctcctggaatatggtatcgacttcaagcgcgtgatgcgcggtcgccttgtt
ctgggcacggccgatggctggctgaaggccgacggagagacgatttatcaggcaaccgat
cttcgggtcggcctgtccaaggataaatccgcctga

DBGET integrated database retrieval system