KEGG   Martelella endophytica: TM49_20640Help
Entry
TM49_20640        CDS       T03801                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mey  Martelella endophytica
Pathway
mey00061  Fatty acid biosynthesis
mey00780  Biotin metabolism
mey01100  Metabolic pathways
mey01130  Biosynthesis of antibiotics
mey01212  Fatty acid metabolism
Module
mey_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mey00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TM49_20640
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    TM49_20640
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    TM49_20640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mey01004]
    TM49_20640
Enzymes [BR:mey01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     TM49_20640
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     TM49_20640
Lipid biosynthesis proteins [BR:mey01004]
 Fatty acid synthase
  Component type
   TM49_20640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AJY47533
UniProt: A0A0D5LVW7
LinkDB All DBs
Position
4427410..4428219
Genome map
AA seq 269 aa AA seqDB search
MSGLMQGKRGLIMGVANNHSIAWGIAKAVHAEGAELAFTYQGDALGRRVHPLAAELGSDF
VVPCDVEDIASVDSVFDAIKERWGKLDFVVHAIGFSDKSELKGQYANTTRENFVRTMVIS
CFSFTEIAKRAAALMPDGGSLLTLTYGGSTAVVPNYNVMGVAKAGLEASMRYLAGDFGPQ
GIRVNAISAGPVRTLAGSGVGDARLVYAWQQRNAPLRRSTTIEDVGGSALYLLSDLAAGV
TGEIHFVDNGYNILSMPIPEMMRRGDPET
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagcggacttatgcagggcaaacgcggcctcatcatgggcgttgccaacaaccactcg
attgcctggggcatcgccaaggccgttcacgccgaaggcgcggaactggccttcacctat
caaggcgatgcgcttggccggcgggtgcatccgctcgcggccgagcttggctcggatttc
gtcgttccttgcgacgtcgaggatatcgccagcgtcgattcggtgttcgacgccatcaag
gagcgctggggcaagctcgatttcgtcgtccatgccatcggtttctccgacaagagcgag
ttgaagggacagtacgccaacacgacgcgggaaaatttcgtccgcaccatggtgatatcc
tgcttctcctttaccgagatcgccaaacgcgctgcggccttgatgccggacggcggctcg
cttctgacgctgacttatggcggatcgaccgcggtcgttccgaactataacgtcatgggc
gttgccaaggccgggcttgaggcatcgatgcgctatctcgccggcgacttcggcccgcag
ggcatccgcgtcaacgccatttcggccggtccggtgcgcacgcttgcaggctccggcgtc
ggcgatgcccgcctcgtctatgcctggcagcagcgcaatgcgccgctgcgccgttcgacc
acgatcgaggacgtcggcggctcggcgctctacctgctatccgacctcgctgcgggcgtc
accggcgagatccacttcgtcgacaacggctacaatattctctccatgccgatcccggag
atgatgcggcgcggcgatccggagacctga

DBGET integrated database retrieval system