KEGG   Methanocella conradii: Mtc_0215Help
Entry
Mtc_0215          CDS       T01774                                 

Definition
(GenBank) ABC-type phosphate transport system, ATPase component
  KO
K06857  tungstate transport system ATP-binding protein [EC:7.3.2.6]
Organism
mez  Methanocella conradii
Pathway
mez02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mez00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Mtc_0215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mez02000]
    Mtc_0215
Enzymes [BR:mez01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.6  ABC-type tungstate transporter
     Mtc_0215
Transporters [BR:mez02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Tungstate transporter
    Mtc_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_30 AAA_25 AAA_15 AAA_13 AAA_23 cobW AAA_22 AAA_29 AAA_16 AAA_33 SbcCD_C TsaE Rad17 AAA DUF3584 RsgA_GTPase NACHT NTPase_1 AAA_18
Motif
Other DBs
NCBI-ProteinID: AFC98986
UniProt: H8I8D3
LinkDB All DBs
Position
211349..212068
Genome map
AA seq 239 aa AA seqDB search
MMISVRGLSKSVNGRAILKNVCLEVGEGEALALVGPNGAGKTTLLRIINMLDTCYEGEVL
INGINVREGGTMLRRSMAMVFQKPVVFSMNVYDNVAYGLRLRKVPRAEMDERVKEVLALL
DMSGREREPARHLSGGEAQRVAFARAYVLKPKLLLLDEPTANLDRNNVAIIEKAIRNINE
RYGTTVVMVTHSLQQARRLARRMAFMMDGELVEAGSIQKMLDDPADARTRAFVSGDMVF
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgatgatatcagtcaggggcctttcgaagagcgtgaacggcagggccatattgaagaac
gtgtgccttgaggtcggggagggcgaggccctggcgctggtcgggccgaacggcgcaggc
aagaccacgctgctacgaataataaacatgctcgacacttgctatgagggcgaggtatta
ataaacgggattaacgtcagggagggcgggacgatgctgaggcggtccatggcgatggtt
ttccagaagcccgtggtcttttccatgaacgtgtacgataacgtggcgtacgggctgagg
ctcaggaaggtgcccagggcggagatggatgagcgggtgaaggaggtgctcgcccttctc
gacatgtcgggccgggaacgggagccggcaaggcacctctccgggggtgaggcgcagcgc
gtcgccttcgcccgtgcctacgtgctcaagccgaagctgctattactagacgagcccacc
gccaacctggacaggaataacgtggccataatagagaaagccataaggaacatcaacgag
cgctacggcacgactgtggtcatggtcacccatagcctgcagcaggccaggaggcttgcc
cggcggatggcgttcatgatggacggcgagctggtcgaggctggcagcattcagaagatg
ctcgacgaccccgccgatgcccgcacgagggctttcgtgagcggcgacatggtattctga

DBGET integrated database retrieval system