KEGG   Methanocella conradii: Mtc_2237Help
Entry
Mtc_2237          CDS       T01774                                 

Definition
(GenBank) thioredoxin reductase (NADPH)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mez  Methanocella conradii
Brite
KEGG Orthology (KO) [BR:mez00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mtc_2237
Enzymes [BR:mez01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Mtc_2237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 FAD_oxidored K_oxygenase NAD_binding_8 Lycopene_cycl NAD_binding_9 DAO Thi4 Amino_oxidase FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFD00972
UniProt: H8IA12
LinkDB All DBs
Position
2126684..2127595
Genome map
AA seq 303 aa AA seqDB search
MSLLDLIVIGAGPAGMTAAIYAKRKGLSLLVITDSVGGQVSSTGRVENYPGLGGVTGPQL
VSAMKKQLEGLSVDIKLGRVSKLEKIGDNFRVTTAGGNAYDARAVIIASGSHWRELGVPG
EKEYKNRGVSYCATCDGPLFAGMDVAVVGGGNSAAEAVLDIINMVSKVYLVVRSTLKADK
VMVDRIMASDKVTVLTGYTVERIHGNDFVEHLDIISKDGERKTLNVGGVFVEIGLSPNVN
FARGLVQLNDRGEIAVDGYCRTSVPGVFAAGDVTSVPQKQIVVAAGEGAKAAMSAYAYLS
IQK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagcctacttgacttgatagttattggagctggcccggcgggcatgactgccgccata
tatgcgaagcgtaagggcctatcactgcttgtaataacggactcggtgggcgggcaggta
tcgagcactggcagagttgagaattaccctggccttggaggcgtcaccggcccgcagctc
gtttccgccatgaaaaaacagctcgaaggtctaagcgtggacatcaagctggggcgggtc
tcgaagctggaaaagattggggataattttagggttactactgcggggggcaatgcctat
gacgccagggctgtaatcatagcctcagggtctcattggagggagcttggcgtgccggga
gagaaggagtataagaataggggcgtgagctattgtgccacatgcgatggcccgctgttc
gcgggcatggacgtcgccgtagttggagggggaaactctgcggctgaggcagtgctcgat
atcataaacatggtttcaaaggtctaccttgtcgtgaggagcacgcttaaggccgataag
gtcatggtagaccgcatcatggcgagcgacaaagtaacggtcttaacaggctataccgtt
gagcgcatacatggcaacgacttcgttgagcacctggatataatatcaaaggatggtgag
cgaaaaacgttgaatgtggggggcgttttcgtcgagatagggctgtcgccaaacgtcaat
ttcgcaagaggccttgtacagcttaacgataggggcgagatagcggttgatggctactgc
cgcaccagcgttccgggcgtgtttgcggccggagacgtgacaagcgttccacagaagcag
atcgtggtggcggctggcgagggcgccaaagccgccatgtcagcctacgcctacctgagc
atccaaaaatag

DBGET integrated database retrieval system