KEGG   Methylobacillus flagellatus: Mfla_1995Help
Entry
Mfla_1995         CDS       T00342                                 

Definition
(GenBank) Lactaldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mfa  Methylobacillus flagellatus
Pathway
mfa00010  Glycolysis / Gluconeogenesis
mfa00620  Pyruvate metabolism
mfa01100  Metabolic pathways
mfa01110  Biosynthesis of secondary metabolites
mfa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfla_1995
   00620 Pyruvate metabolism
    Mfla_1995
Enzymes [BR:mfa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Mfla_1995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABE50262
UniProt: Q1GZS5
LinkDB All DBs
Position
complement(2133187..2134707)
Genome map
AA seq 506 aa AA seqDB search
MSLDSLKGLGIKVPYKNKYDNYIGGQWVAPVDGEYFDNISPVTGKVFCQVPRSNEKDINL
ALDAAHAAKEAWARTSGTGRANILLKIADVMEANLETIAIAETIDNGKPIRETMAADIPL
AIDHFRYFASCIRTQEGGISEIDHETVAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCIVMKPAEQTPASILVVMELIGDLLPPGVLNVVNGHGVEAGKALATSPRIAKIAFTG
STSVGRLIMQYASQNLIPVTLELGGKSPNIFFEDVMDKDDAYFDKALEGFTLFALNQGEI
CTCPSRALIQESIYEQFIERAIKRVKAIKQGSPLDKSTMIGAQASSEQVEIIMSYIKLGL
EEGAQLLTGGNATKLPGDLSEGYYIEPTVFKGHNKMRIFQEEIFGPVLSVTTFKDEKEAL
EIANDTMYGLGAGLWTRDGSRAYRVGRGIQAGRVWTNCYHLYPAHAAFGGYKQSGIGREN
HRMMLDHYQQTKNLLVSYSPNALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagtctggatagcttgaaaggcctaggtattaaggttccgtacaaaaataagtatgac
aattatattggagggcaatgggttgcgccggtggatggcgagtacttcgacaacatcagc
ccggtgactggcaaggtattctgccaggtgccgcgatcgaatgaaaaggatatcaacctg
gccttggatgccgcacatgcggccaaggaggcctgggccaggacttcagggaccggacgt
gccaatatcctcctcaagattgccgatgtgatggaagccaacctggaaactatcgcgatt
gcggagaccatcgataacggaaagcccatccgtgaaaccatggctgccgacattccgctg
gcgatcgaccatttccgttatttcgctagttgcatccgtacccaggaaggcggtatcagc
gaaatcgatcatgagactgtggcttatcacttccatgagccgctgggtgtggtcggccag
atcattccatggaacttccctattttgatggcagcatggaagctggccccagcgctggct
gcgggcaattgtatcgtcatgaaacctgctgagcagacgccggcgtcgattttggttgtc
atggagctgataggcgatctattgcctcccggcgtgctgaatgtggtgaatggccatggc
gtcgaggcgggaaaggcgcttgcaaccagtccgcgtatcgccaagattgccttcaccggc
tccacctccgttggccgactgatcatgcaatacgcgagccagaacttgattccggtgaca
ctcgagcttggcggcaagtctcccaatatcttctttgaagatgtgatggataaggacgat
gcctatttcgataaggcactggaaggttttaccctgttcgcattgaaccaaggcgaaatc
tgcacctgtcctagccgtgcactgatccaggagtccatctacgaacagttcatcgagcgt
gcgatcaagcgtgtcaaggcgatcaaacagggcagtccactggacaagtccacaatgatc
ggggcgcaggcttccagcgagcaggtagagatcatcatgtcctatatcaagttgggactg
gaagagggcgcacagttgctgaccggcggaaatgcaaccaagctgccaggcgacctgagc
gaaggctactatatcgagccaaccgtgttcaagggccacaacaagatgcgcattttccag
gaagaaatcttcgggccggttttgtctgttacgactttcaaggacgagaaggaagcgctg
gaaatcgccaatgacaccatgtacggcctgggtgcaggtttatggacccgtgacggcagc
cgtgcttaccgtgttggtcgcgggatccaggccggccgcgtctggaccaattgctaccac
ttgtatccagcgcacgctgcattcggcggttataagcagtccggcattggccgcgagaac
caccgcatgatgctggatcattaccagcaaaccaagaatctcctggtcagttacagcccc
aatgcattgggctttttctag

DBGET integrated database retrieval system