KEGG   Methanobacterium formicicum BRM9: BRM9_0570Help
Entry
BRM9_0570         CDS       T03396                                 

Definition
(GenBank) TrkA domain-containing protein
Organism
mfc  Methanobacterium formicicum BRM9
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_C PhoU
Motif
Other DBs
NCBI-ProteinID: AIS31393
UniProt: A0A090I729
LinkDB All DBs
Position
complement(582275..582880)
Genome map
AA seq 201 aa AA seqDB search
MPKSIKDILIEMKNMSELMVDLAYSALLFNSKDAAEEVIKLENKVNRLNYEIKKESLLAA
RTVEDAEKLTALLEVGEAAETIADSAKDIADLVLKGMKPHPVFKMVMEESDEVIMRVKIS
EGSELIDKSLGELLLATRTGMTVIAIRRNESWIYGPDKNTMISAGDALIVKGNETGGSLL
TQLASGETKLEDLEYEEFTED
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgcctaaaagtattaaggacattttaattgaaatgaagaacatgtccgagttaatggtt
gatttagcttattctgcattactattcaatagtaaagatgctgcagaagaagttataaaa
cttgaaaataaagttaataggcttaattacgaaattaagaaagaatccctcctggctgcc
aggacagtggaggatgccgaaaaattaactgccctccttgaggtgggggaagcagcagaa
accatagctgattctgcaaaagatatagctgacctggttttaaaaggtatgaaaccacac
cctgttttcaaaatggttatggaagagtcagatgaagtcataatgagagtaaaaatctca
gagggatccgagctaattgataaatctctaggagaacttctacttgctacccggacggga
atgacagttatcgccataaggagaaatgaatcctggatctatggacccgacaaaaacacc
atgatctctgccggagatgcactaatagtcaaggggaatgaaactggaggatctctactc
acacaacttgccagtggggaaaccaagctagaagatctggaatatgaagaatttacagaa
gattag

DBGET integrated database retrieval system