KEGG   Methanobacterium formicicum BRM9: BRM9_0749Help
Entry
BRM9_0749         CDS       T03396                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mfc  Methanobacterium formicicum BRM9
Pathway
mfc00250  Alanine, aspartate and glutamate metabolism
mfc00410  beta-Alanine metabolism
mfc00430  Taurine and hypotaurine metabolism
mfc00650  Butanoate metabolism
mfc01100  Metabolic pathways
mfc01110  Biosynthesis of secondary metabolites
mfc01120  Microbial metabolism in diverse environments
mfc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mfc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BRM9_0749
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BRM9_0749
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BRM9_0749
   00430 Taurine and hypotaurine metabolism
    BRM9_0749
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BRM9_0749
Enzymes [BR:mfc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BRM9_0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AIS31569
UniProt: A0A089ZV00
LinkDB All DBs
Position
complement(759202..760590)
Genome map
AA seq 462 aa AA seqDB search
MLSEKLDLGKLKRSEREHTTTYGSRYFSESIPKYEMPEDGMPAKAAYQLIHEELNLDGNP
ALNLASFVTTWMEPEADQLIMDTMGKNYVDNDEYPQTSKIQDRVVNMLARLFNAPHECKS
VGTGTIGSSEAIMLGLLAHKWTWRQRREKEGKPADKPNIVMGADVHTVWEKFARYFDVEL
KLIPLTRDHYTITARDVAQEVDENTIAVGAVIGTTFAGQMDPIKEINDLLVDIKKTKGWD
IPIHVDGASGGFVAPFIFPDMEWDFRLEQVKSINVSGHKYGLVYPGVGWIIFKDKSDLPE
DLIFDINYLGGLMPNYSLNFSKGSSTIIAQYYNLIRLGRKGYKDIMTNMFDNTLYLAGEL
ENSGKFELINKNIIVPLVAVTLKNADFTVFQLSEKLREKGWIVPAYTLPADAEDVAVLRI
VVKENFGRDMVEMLLEDLMEAYHKLEKEGPKAVKESNPTLLY
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ttgttatcagaaaaattagacctggggaaactgaaaagatcagaaagggaacacaccacc
acctatggaagtcgctactttagtgagagtatcccgaaatacgagatgcctgaagatgga
atgcccgctaaagcagcctaccagttgatacacgaggaactgaacctggatgggaatccc
gcccttaacctggccagtttcgtaaccacctggatggaacccgaggctgaccagctgatc
atggataccatgggtaaaaactacgtggacaacgatgaatacccccagacctccaaaatc
caggaccgggtggttaacatgttagcccggctctttaacgcaccccacgagtgcaaatca
gtgggaaccggaaccatcggatcctcagaggccatcatgctgggacttctggcccataaa
tggacctggaggcagcgaagggaaaaagagggcaaacccgcggataaacccaacatagtc
atgggggccgatgtgcacacggtgtgggagaagttcgcccgctacttcgacgtggaactg
aagttaatacccttaacccgggatcattacaccataactgcccgggacgtggcccaggaa
gttgatgaaaacaccatagccgtaggggcagtcattgggacaaccttcgccggacaaatg
gacccaatcaaggaaataaacgatttactggtggatatcaagaaaactaaaggatgggat
atacccatacatgtggatggggccagtgggggctttgtggcaccattcattttcccggac
atggaatgggacttcagactggaacaggtgaaatccatcaatgtatcgggccataagtac
ggcctggtgtacccgggagtgggctggataatattcaaggacaaatccgacctgcctgaa
gatctgatattcgatatcaactacctggggggattgatgcccaattactcccttaatttt
tccaagggaagcagtaccataatcgcccagtactataacctcatcaggctgggtaggaag
ggttataaggatataatgaccaacatgttcgataacaccctttatctggccggtgaactt
gaaaattctggtaaatttgaacttatcaataaaaacatcattgtccccctggtggcggta
actctaaagaacgcagatttcacggttttccagctttcagaaaaactgcgggagaaggga
tggattgtcccggcctacactctgcccgccgatgccgaagatgtggctgtcctgcgaatt
gtggttaaggaaaacttcggccgggatatggtggaaatgctcctggaggatctgatggaa
gcctaccataaactggaaaaagagggacctaaagcggtgaaggaatctaaccccacctta
ctttattga

DBGET integrated database retrieval system