KEGG   Methanobacterium formicicum BRM9: BRM9_0771Help
Entry
BRM9_0771         CDS       T03396                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase alpha subunit PorA
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mfc  Methanobacterium formicicum BRM9
Pathway
mfc00010  Glycolysis / Gluconeogenesis
mfc00020  Citrate cycle (TCA cycle)
mfc00620  Pyruvate metabolism
mfc00633  Nitrotoluene degradation
mfc00640  Propanoate metabolism
mfc00650  Butanoate metabolism
mfc00680  Methane metabolism
mfc00720  Carbon fixation pathways in prokaryotes
mfc01100  Metabolic pathways
mfc01110  Biosynthesis of secondary metabolites
mfc01120  Microbial metabolism in diverse environments
mfc01130  Biosynthesis of antibiotics
mfc01200  Carbon metabolism
Module
mfc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mfc_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mfc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRM9_0771 (porA)
   00020 Citrate cycle (TCA cycle)
    BRM9_0771 (porA)
   00620 Pyruvate metabolism
    BRM9_0771 (porA)
   00640 Propanoate metabolism
    BRM9_0771 (porA)
   00650 Butanoate metabolism
    BRM9_0771 (porA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    BRM9_0771 (porA)
   00680 Methane metabolism
    BRM9_0771 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BRM9_0771 (porA)
Enzymes [BR:mfc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     BRM9_0771 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N NAPRTase
Motif
Other DBs
NCBI-ProteinID: AIS31591
UniProt: A0A089Z9W1
LinkDB All DBs
Position
782601..783749
Genome map
AA seq 382 aa AA seqDB search
MVQKVYSSNRAVAEAVKMAKPNVVPVYPITPQTTISEYLAQFVADGDLKAEYIRVESEHS
AISAALGASGAGVRVFSATSSQGLALMHEILFAAAGMRSPIVLVDANRALSAPLSIWNDQ
QDSISERDSGWLQIYAENAQEALDAVLIAYRVAEDPEVLLPCMVCIDGYFLTHTVEPLDV
PSQEEVDQFLPPYKPYAFLDPEKPMSIGTFTDPDYYMEARYAIEAAMEKSKNVISKANQE
FKEVFGREYDLVETYRCDDAEIIMVAMGSLCGTIKDVIDDLREEGEKVGLLKIRVFRPFP
TEEIKEVLEKASKVAVIDKNISFGMGGVLYNNIRATTNANAHGFIAGLGGRDITPTFLRE
IIEKTKNPTGEVEWIGLKKEEL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaaaagtttattcttccaaccgagccgtggctgaagccgttaaaatggccaaa
cccaacgtagttcctgtttatcccataacaccccaaacaaccatttccgaatatctggcc
cagtttgtggccgacggggacctgaaagcagaatacatccgtgtggaatctgaacacagt
gccataagtgctgctttaggtgcttccggagccggtgttcgagttttcagtgcaacctca
tcccagggtctggccctgatgcacgaaatactgtttgctgcggctggtatgcggagcccc
attgtactggtggatgcaaaccgagcactatctgcaccactgagtatatggaacgatcaa
caggattcaatttctgaacgtgactcaggatggctgcagatatacgcagaaaacgcacag
gaagccctggacgcagttttgatagcctaccgagtggccgaagacccagaagtcttacta
ccctgcatggtctgtatcgatggatacttcctgacccacactgtggaaccactggatgtg
cccagccaggaagaggtggaccagttcttaccaccctacaagccctacgctttcctggac
ccggaaaaacccatgtccattggaaccttcactgacccggactactacatggaagcccgt
tacgccatagaagcagccatggaaaaatccaaaaacgtcatatccaaggccaaccaggaa
tttaaagaagtgttcggccgggaatatgatctcgttgaaacttaccggtgcgatgacgcc
gaaatcatcatggtagccatgggctcactctgtggaaccataaaagatgttatcgatgat
cttagagaagaaggagaaaaagtaggactcctgaaaatcagggtgttccgtcccttcccc
accgaagaaattaaagaagtcctggaaaaagcttccaaagtggcagtgattgataaaaac
atctcatttggaatgggaggagtgctctacaacaacatccgagccaccaccaatgccaac
gcccatggatttatagctggactgggaggaagagatataactcctacattcctcagggaa
atcattgaaaaaactaaaaaccccaccggagaggtggaatggatcggactcaaaaaggag
gaactctaa

DBGET integrated database retrieval system