KEGG   Methanocaldococcus fervens: Mefer_1318Help
Entry
Mefer_1318        CDS       T00976                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mfe  Methanocaldococcus fervens
Pathway
mfe00630  Glyoxylate and dicarboxylate metabolism
mfe01100  Metabolic pathways
mfe01120  Microbial metabolism in diverse environments
mfe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mefer_1318
Enzymes [BR:mfe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Mefer_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ACV25127
UniProt: C7P995
LinkDB All DBs
Position
1243967..1245244
Genome map
AA seq 425 aa AA seqDB search
MDYIDLNYTPNENDLLSCMIIKGENLEKLANEIAGESSIGTWTKVQTMKSDIYTKLKPKV
YEIKEIGNEGRYKIGLIKIAYPLYAFEINNMPGVLAGIAGNIFGMKIAKGLRILDFRFPE
EFVKSYKGPRFGIEGVRKTLKIKERPLLGTIVKPKVGLRTEEHAKVAYEAWVGGVDLVKD
DENLTSQEFNKFEDRVYKTLEMRDKAEEETGERKAYMPNITAPYREMLRRAEIAEDAGSE
YVMIDVVVSGFSAVQSFREEEFNFIIHAHRAMHAAITRGRDFGISMLALAKIYRLLGVDQ
LHIGTVVGKMEGGEKEVKAIRDEIVYDKVEADNENKFFNQEWFGINPIFPVSSGGVHPKL
VPKIVEILGRDLIIQAGGGVHGHPDGTKAGAKAMRAAIEAVVEGKSLEEKAEEVEELKKA
LGYWK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggattacatagatttaaattatactccaaacgaaaatgatttgttatcatgcatgata
atcaaaggagaaaatttagaaaaattggcaaatgagattgctggtgagagttctattgga
acatggactaaagttcaaacaatgaagagcgatatttatacaaaattaaaaccaaaagtt
tatgaaattaaagagattggaaatgaaggcagatacaaaataggcctaataaagattgct
tatccgttgtatgcttttgaaataaacaacatgccaggggttttggcagggattgctgga
aatatatttggaatgaagattgccaaaggtttgaggatattagattttagatttccagaa
gagtttgttaaatcctataaaggcccaagatttggaattgaaggggttagaaaaactctt
aaaattaaggaaagaccattattgggaactatagttaaaccaaaagtgggtttaaggaca
gaggagcatgcaaaagtggcttacgaagcatgggtaggaggggttgatttagttaaggat
gatgaaaacttaacgtcccaagaatttaacaaatttgaagatagagtttataaaaccttg
gagatgagggataaggcggaggaagagactggagaaaggaaggcatatatgccaaatata
acagccccatacagagaaatgctgaggagggcagagattgctgaagacgctggaagtgaa
tatgtgatgattgacgtggttgttagcgggttttcagcagttcaatcattcagagaggag
gaatttaattttataatacatgcacatagggcaatgcatgcggcaataacaagagggagg
gattttggaatatcgatgctcgcattagccaagatttacaggttgttgggagttgatcaa
ctgcatataggaacggttgttggaaaaatggaaggaggagagaaggaggttaaagcaatt
agggatgagatagtttatgataaggttgaggcagataacgaaaacaaatttttcaatcaa
gaatggtttggtattaatccaatattcccagtatcttcaggaggagttcatcctaagttg
gttccaaaaatagttgaaattttaggaagagatttaattatacaagctggaggaggggtg
catgggcatccagatggaactaaagctggagctaaggcaatgagagcggctatagaggca
gttgtagaagggaagtcgttggaagaaaaggctgaagaagttgaagaattaaagaaggca
ttggggtattggaaataa

DBGET integrated database retrieval system