KEGG   Methanobacterium formicicum DSM1535: DSM1535_0708Help
Entry
DSM1535_0708      CDS       T03743                                 

Gene name
GAD
Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mfi  Methanobacterium formicicum DSM1535
Pathway
mfi00250  Alanine, aspartate and glutamate metabolism
mfi00410  beta-Alanine metabolism
mfi00430  Taurine and hypotaurine metabolism
mfi00650  Butanoate metabolism
mfi01100  Metabolic pathways
mfi01110  Biosynthesis of secondary metabolites
mfi01120  Microbial metabolism in diverse environments
mfi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DSM1535_0708 (GAD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DSM1535_0708 (GAD)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DSM1535_0708 (GAD)
   00430 Taurine and hypotaurine metabolism
    DSM1535_0708 (GAD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DSM1535_0708 (GAD)
Enzymes [BR:mfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     DSM1535_0708 (GAD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CEA13064
UniProt: A0A090I2H7
LinkDB All DBs
Position
complement(709931..711319)
Genome map
AA seq 462 aa AA seqDB search
MLSEKLDLGKLKRSEREHTTTYGSRYFSESIPKYEMPEDGMPAKAAYQLIHEELNLDGNP
ALNLASFVTTWMEPEADQLIMDTMGKNYVDNDEYPQTSKIQDRVVNMLARLFNAPHECKS
VGTGTIGSSEAIMLGLLAHKWTWRQRREKEGKPADKPNIVMGADVHTVWEKFARYFDVEL
KLIPLTRDHYTITARDVAQEVDENTIAVGAVIGTTFTGQMDPIKEINDLLVDIKKTKGWD
IPIHVDGASGGFVAPFIFPDMEWDFRLEQVKSINVSGHKYGLVYPGVGWIIFKDKSDLPE
DLIFDINYLGGLMPNYSLNFSKGSSTIIAQYYNLIRLGRKGYKDIMTNMFDNTLYLAGEL
ENSGKFELINKNIIVPLVAVTLKNADFTVFQLSEKLREKGWIVPAYTLPADAEDVAVLRI
VVKENFGRDMVEMLLEDLMEAYHKLEKEGPKAVKESNPTLLY
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ttgttatcagaaaaattagacctggggaaactgaaaagatcagaaagggaacacaccacc
acctacggaagtcgctactttagtgagagtatcccgaaatacgagatgcctgaagatgga
atgcccgctaaagcagcctaccagttgatacacgaggaactgaacctggatgggaatccc
gcccttaacctggccagtttcgtaaccacctggatggaacccgaggctgaccagctgatc
atggataccatgggtaaaaattacgtggacaacgatgaatacccccagacctccaaaatc
caggaccgggtggttaacatgttagcccggctctttaacgcaccccacgagtgcaaatca
gtgggaaccggaaccatcggatcctcagaggccatcatgctgggacttctggcccataaa
tggacctggagacagcgaagggaaaaagagggcaaacccgcggataaacccaacatagtc
atgggggccgatgtgcacacggtgtgggagaagttcgcccgctacttcgacgtggaactg
aagttaatacccttaacccgggatcattacaccataactgcccgggacgtggcccaggaa
gttgatgaaaacaccatagccgtaggggcagtcattgggacaaccttcaccggacaaatg
gacccaatcaaggaaataaacgatttactggtggatatcaagaaaactaaaggatgggat
atacccatacatgtggatggggccagtgggggctttgtggcaccattcattttcccggac
atggaatgggacttcagactggaacaggtgaaatccatcaatgtatcgggccataagtac
ggcctggtgtacccgggagtgggctggataatattcaaggacaaatccgacctgcctgaa
gatctgatattcgatatcaactacctggggggattgatgcccaattattcccttaatttt
tccaagggaagcagtaccataatcgcccagtactataacctcatcaggctgggtaggaag
ggttataaggatataatgactaacatgttcgataacaccctttatctggccggtgaactt
gaaaattctggtaaatttgaacttatcaataaaaatatcattgtccccctggtggcggta
actctaaagaacgcagatttcacggttttccagctttcagaaaaactgcgggagaaggga
tggattgtcccggcctacactctgcccgccgatgcagaggatgtggctgtcctgcgaatt
gtggttaaggaaaacttcggccgggatatggtggaaatgctcctggaggatctgatggaa
gcctaccataaactggaaaaagagggacctaaagcggtgaaggaatctaaccccacctta
ctttattga

DBGET integrated database retrieval system