KEGG   Mycobacterium florentinum: MFLOJ_23910
Entry
MFLOJ_23910       CDS       T06524                                 

Definition
(GenBank) hypothetical protein
  KO
K15751  carbazole 1,9a-dioxygenase [EC:1.14.12.22]
Organism
mfj  Mycobacterium florentinum
Pathway
mfj00621  Dioxin degradation
mfj01100  Metabolic pathways
mfj01120  Microbial metabolism in diverse environments
mfj01220  Degradation of aromatic compounds
Module
mfj_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:mfj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    MFLOJ_23910
Enzymes [BR:mfj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.22  carbazole 1,9a-dioxygenase
     MFLOJ_23910
SSDB
Motif
Pfam: Aromatic_hydrox Rieske VanA_C Rieske_2
Other DBs
NCBI-ProteinID: BBX78604
LinkDB
Position
complement(2535507..2536664)
AA seq 385 aa
MTAADQRIETGVASKWPRYLQAELGFSNHWHPALFGHELAEGGFASVKMLGTQILLTRVD
GQVRAIADQCAHRGVRFSAQPLCFQKGTVSCWYHGWTYSLADGQLTDVLTSPESPVIGQV
GIPVFAVEEQQGLIFVFVGDQEPPALSEDVPPGFLDTDTHCLGIRRTVAANWRLGVENGF
DTTHIFMHRDSPLVSGNKLALPYGFVPADRGAMEVHSQGWPKGVVDNLAQNYKPVFEAQL
GGQPVLQCQLSGDEKRVAARVSVWLPGVLKVDPFPDPTLVQYEFYVPVGANEHEYFQVLQ
RKVTNEADVQAFEDEFENKWRDLALHGFNDDDVWAREAQEEFYSHQNGWANEHLFPPDMC
ITKWRQLASTHARGISRGLRSGGGS
NT seq 1158 nt   +upstreamnt  +downstreamnt
gtgactgccgccgaccaacgaatcgaaacaggcgtggcttcgaagtggccgcggtatctg
caggccgaactgggcttcagcaatcactggcacccggccctgttcggccacgaactggcc
gaaggcgggttcgcatcggtgaagatgctgggcacgcagattctgctgacccgtgtcgac
gggcaagtgcgcgcgatcgcggatcagtgcgcgcaccgcggcgtgcggttctccgcgcag
cccttgtgttttcagaagggcaccgtgtcgtgctggtaccacggctggacctacagcctg
gccgacgggcagctcaccgatgtgctgacatctccggaatcgccggtgatcgggcaggtc
ggtatccccgtcttcgcggtcgaagaacaacagggcctgatcttcgtgttcgtcggcgac
caggagccccccgcgttgagtgaggacgttccgccgggatttctcgacaccgacacccac
tgcctggggatccgccgcaccgtcgcggcgaactggcggcttggtgtggagaacggcttc
gacaccacccacatcttcatgcatcgcgactcaccgctggtctccggcaacaaactcgct
ctgccatacgggtttgtcccggccgaccgcggggcgatggaggtccactcacagggctgg
cccaaaggcgtggtggacaatctcgcccagaactacaagccggtcttcgaagcgcagctg
ggcggccagcccgtgctgcaatgccagctgtccggcgatgaaaagcgagtagccgcacgg
gtaagcgtgtggctgccgggagtgctcaaggtcgatcccttcccggaccccacgctggtg
cagtacgagttctatgttccggtcggtgccaacgagcacgagtacttccaggtgttgcag
cgcaaggtcacaaacgaggccgacgtccaggccttcgaggacgagttcgagaacaagtgg
cgcgacctcgccttgcacggattcaacgacgacgacgtctgggctcgtgaggcgcaagaa
gagttctacagccaccaaaacggatgggctaacgagcacctgttcccgcccgacatgtgc
atcaccaagtggcggcaactcgcgtccacccacgctcgcggcatctctcggggtctgcga
agcggtggtggctcgtaa

DBGET integrated database retrieval system