KEGG   Mycobacterium florentinum: MFLOJ_23980
Entry
MFLOJ_23980       CDS       T06524                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K15756  2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase [EC:3.7.1.13]
Organism
mfj  Mycobacterium florentinum
Pathway
mfj00621  Dioxin degradation
mfj01100  Metabolic pathways
mfj01120  Microbial metabolism in diverse environments
mfj01220  Degradation of aromatic compounds
Module
mfj_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:mfj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    MFLOJ_23980
Enzymes [BR:mfj01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.13  2-hydroxy-6-oxo-6-(2-aminophenyl)hexa-2,4-dienoate hydrolase
     MFLOJ_23980
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF1057 Esterase Abhydrolase_4 Ndr Abhydrolase_8 FSH1 BAAT_C
Other DBs
NCBI-ProteinID: BBX78611
LinkDB
Position
complement(2541982..2542833)
AA seq 283 aa
MTATTTAPRDSSIEVGQVSTRYWEAGDGAPVVLIHGGGAGADAWGNWVTSIPMFSARFRT
IAYDMVGFGQSLPGDDAFEYSQPARVAHLAAFLDALGLEKVSLVGNSMGGATALGLAMTD
PARVSKLVLMGSAGLNRSFSPQLQTILNYAEPNLDGMARIVDALTHESFTPPKGLVEYRY
KLTCDDKVMDAYRRTMAWVKDQGGLHFEESDIATVKVPTLVVSGREDAVVPLLESVRFHQ
LIDRSHLYAIPRCGHWAMLEHPKEFARISIDFLLAEDERDESV
NT seq 852 nt   +upstreamnt  +downstreamnt
atgaccgcgacgacaacggccccgcgagacagctccatcgaagtcggccaagtcagcacc
cgctactgggaagcaggcgacggcgcgcccgtggtgctgatccacggcggcggtgccggc
gccgacgcctggggaaactgggtgacgtcgatccccatgttctcggctcgtttccgcacc
atcgcctacgacatggtcgggttcggacagagcctgcccggcgacgacgcgttcgagtac
tcgcaaccggcccgcgtcgcgcatctagcggcctttctcgacgcgctggggctcgagaag
gtgtctctggtcggcaactcgatgggcggcgcgaccgcactcgggctggcgatgaccgat
ccggcccgggtcagcaagctggtcctgatgggcagcgccgggcttaaccgaagcttctcg
ccgcagctgcagacgatcttgaactacgccgagcccaacttggacggcatggcgagaatc
gtcgatgcgctgactcacgaaagtttcacgccaccaaagggtctcgtcgagtaccggtac
aaactcacctgcgacgacaaggtgatggacgcctaccggcgcacgatggcctgggtcaaa
gaccaaggcgggctgcacttcgaggaaagcgatatcgccacggtaaaggttccgacgctg
gttgtttccgggcgcgaggacgcggtagtgccgttgcttgagtccgtccgcttccaccag
ctcatcgaccggtctcacctgtacgcgattccacgttgcggccattgggcgatgttggag
catcccaaggagtttgcccgcatctcgatcgacttcctgctggcagaggacgaacgcgat
gagtccgtctga

DBGET integrated database retrieval system