KEGG   Methanoregula formicica: Metfor_1008Help
Entry
Metfor_1008       CDS       T02392                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase, archaeal type
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mfo  Methanoregula formicica
Pathway
mfo00620  Pyruvate metabolism
mfo00680  Methane metabolism
mfo00720  Carbon fixation pathways in prokaryotes
mfo01100  Metabolic pathways
mfo01120  Microbial metabolism in diverse environments
mfo01200  Carbon metabolism
Module
mfo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Metfor_1008
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metfor_1008
   00680 Methane metabolism
    Metfor_1008
Enzymes [BR:mfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Metfor_1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGB02060
UniProt: L0HDG7
LinkDB All DBs
Position
complement(988959..990395)
Genome map
AA seq 478 aa AA seqDB search
MSTQHPDNVHVPFFAETSELGGEDEVKEAYYIYSHLGCHEQMWDCEGKEVDNFVVKKLLT
TYSPFFADNILGKDIFLTLRVPNPHIEKAEAKILLETLESIPRSFDVARIFYKNDIPPIF
EVILPMTDTHTAIDNIYQYYADFVIGKQFKRLGGRDTTIADWIGTFSPKHINVIPLFEDQ
TSMLSAHTTVGRYILDKHLPYQRVFLARSDPAMNYGLVSAVLLNKIALANLHRLQEETGV
PVYPVIGVGSAPFRGNLRPDTVDRVSAEYPSAYTFTIQSAFKYDYPPDEARNAVRALESR
AVSTPHRVDETQCLQIMERYTEAYIRELIPLSDIINRIAGHIPGRRKRKLHIGLFGYSRN
TGGMKLPRAITFTAALYSIGIPPEILGLSALSDRDLDFVRRIYVNFDRDLCDAARYLNPD
SPYLGEGMKDALLSITGDRINDDHRQATENILRALRESRTAEIQSDILHAANIRKFLG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccagcacccggacaatgtccatgttccgtttttcgcagagacgtccgaactt
ggtggcgaggacgaagtgaaggaggcgtattacatctattcgcatctcggttgccacgag
cagatgtgggactgcgagggaaaagaggtggacaattttgtggtcaagaaactgctgaca
acgtactccccgttctttgccgacaatatcctcgggaaggatattttcctgactctccgg
gtgccaaacccccatatcgagaaagccgaggcaaagatcctgctggaaaccctggagagc
attccccgctccttcgatgtcgcccggattttctataagaacgatatccctcccatcttc
gaggtcatccttcccatgaccgacacccatacggccatcgacaatatctaccagtactat
gcggacttcgtgattgggaagcagttcaaacggctcgggggacgggataccacgattgct
gactggatcggaacattctcccccaaacatatcaacgtcataccgctgttcgaggaccag
acgagcatgctgtcggcccatacaacggtgggacggtacatcctcgacaagcacctcccc
taccagcgggtctttctggcccgttcagaccctgcgatgaactacgggcttgtcagtgcc
gtgctgctcaacaagatcgcgctggcaaacctccaccggttgcaggaggagaccggcgtc
ccggtatatccggtcatcggcgtaggctccgccccgttccgggggaatctgcggcccgat
acggtcgaccgggtaagcgccgaatatccctccgcgtacacgttcaccatccagtctgcg
ttcaagtacgattatcctcctgatgaagcaaggaacgccgtccgtgcgctggagtcgcgg
gcggtatccacccctcaccgtgtcgatgaaacgcagtgcctgcagatcatggaacgctat
acagaggcctatatccgcgagctcatccccctttcggatatcatcaaccgtatcgccggg
catatccccggtcgccgaaaacggaaactgcatatcggattgttcggctattcccgcaat
acgggaggcatgaaactcccccgcgccatcacgttcacggcggccctgtactccatcggg
ataccccccgagatcctcgggctctcggcactgagtgacagggacctcgacttcgtgcgc
cggatctatgtcaattttgaccgcgatctctgcgatgcggcccgttacctgaacccggac
tcgccctatctgggtgaagggatgaaagatgccctcctgagcatcaccggagacagaatc
aacgatgaccaccgccaggcaacggagaacatcctaagggccctgcgcgagagccggact
gctgagattcagtcggatatcctgcatgcagccaatatcaggaaattcctcgggtag

DBGET integrated database retrieval system