KEGG   Methanoregula formicica: Metfor_2134Help
Entry
Metfor_2134       CDS       T02392                                 

Definition
(GenBank) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, C subunit
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
mfo  Methanoregula formicica
Pathway
mfo00970  Aminoacyl-tRNA biosynthesis
mfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Metfor_2134
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mfo03029]
    Metfor_2134
Enzymes [BR:mfo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Metfor_2134
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Metfor_2134
Mitochondrial biogenesis [BR:mfo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Metfor_2134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AGB03140
UniProt: L0HGK2
LinkDB All DBs
Position
2080741..2081010
Genome map
AA seq 89 aa AA seqDB search
MVTEQDVQHIAELADVGIGAGELENFTHQFNAILEYFDILDRVEGQGEGARDHYNVLRED
EVEPSLPQEEVLRNAPAQEDGFIKAPRVM
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atggtcactgaacaagacgtacaacatatcgcggaactggccgatgtcggtatcggcgcc
ggagaactggagaattttacccaccagttcaacgccattctcgaatatttcgatatcctc
gaccgtgtcgaggggcagggcgagggagcgcgcgatcactataatgtcctgcgcgaggac
gaggtcgagccctcgctcccgcaggaagaggtgctccgcaatgcaccggcacaggaagac
ggattcatcaaggccccgagggtgatgtag

DBGET integrated database retrieval system