KEGG   Methanoregula formicica: Metfor_2442
Entry
Metfor_2442       CDS       T02392                                 

Definition
(GenBank) putative membrane protein
Organism
mfo  Methanoregula formicica
SSDB
Motif
Pfam: DUF63 OST3_OST6
Other DBs
NCBI-ProteinID: AGB03442
UniProt: L0HFC3
LinkDB
Position
2398022..2398867
AA seq 281 aa
MIAEFITKYYIDPIRYGQPYNVVDTLTYAIILIIAVYLIYRWLNSTGISVDRKFVLATVP
FIVLGGLLRVVEDTGFITSDIRFLLITPLIYFVLFFFTVAALLLSRTLERAGIIASYHTG
YAGIGTLACTISAAFLVWWGLTYSQVAVSVLLIIMGLAIVISAGVWGFMRYVLKWEYVSD
PLYCVLIFGQLLDASATSYGIDLHSMAYNEAHVVGGALIAWTGTAFSMFPLKLVILFPAI
YILQQYRKEAAPVFWHLVLLAMIIVGFAPGVRDMVRMILFT
NT seq 846 nt   +upstreamnt  +downstreamnt
atgattgccgaattcatcacaaagtattacattgatcccatccggtacggacagccgtac
aatgttgtggacaccctgacctatgcaatcatcctcatcattgcagtgtacctcatctac
cggtggctgaacagtacaggaatctcggtggataggaaatttgtccttgctaccgtcccg
ttcattgtccttgggggactcctgcgggttgtggaagacaccggtttcatcacgtccgac
attcgtttcctcctgatcacgccgctgatttatttcgtcctgttcttcttcaccgtcgcg
gcgctcctgctgtcgcggaccctggagcgtgccgggatcatcgcctcctaccataccggg
tatgccgggatcggaacactcgcctgcacgatctccgcagcattcctggtatggtggggg
ctgacctattcgcaggttgcggtgagtgtccttctcatcatcatgggtctggcaattgtc
atctctgccggtgtctggggattcatgcggtatgtgctcaaatgggaatatgtaagcgat
ccgctctattgcgtgctcatcttcgggcagttgttggatgcaagtgccacgagttatggt
atcgaccttcactccatggcatacaacgaagcccatgttgtcgggggagccctgattgca
tggaccgggacggcattctcgatgttccccttaaaactggtaatcctgttccctgcgatt
tatattctccagcagtaccggaaggaagcagccccggtcttctggcacctggtcctgctt
gctatgatcattgtgggatttgcaccgggcgtgcgggacatggtccgaatgatattgttc
acgtaa

DBGET integrated database retrieval system