KEGG   Methanoregula formicica: Metfor_2540Help
Entry
Metfor_2540       CDS       T02392                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mfo  Methanoregula formicica
Pathway
mfo00010  Glycolysis / Gluconeogenesis
mfo00020  Citrate cycle (TCA cycle)
mfo00620  Pyruvate metabolism
mfo00640  Propanoate metabolism
mfo00650  Butanoate metabolism
mfo00680  Methane metabolism
mfo00720  Carbon fixation pathways in prokaryotes
mfo01100  Metabolic pathways
mfo01110  Biosynthesis of secondary metabolites
mfo01120  Microbial metabolism in diverse environments
mfo01130  Biosynthesis of antibiotics
mfo01200  Carbon metabolism
Module
mfo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mfo_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metfor_2540
   00020 Citrate cycle (TCA cycle)
    Metfor_2540
   00620 Pyruvate metabolism
    Metfor_2540
   00640 Propanoate metabolism
    Metfor_2540
   00650 Butanoate metabolism
    Metfor_2540
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metfor_2540
   00680 Methane metabolism
    Metfor_2540
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metfor_2540
Enzymes [BR:mfo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metfor_2540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AGB03534
UniProt: L0HKD9
LinkDB All DBs
Position
2486276..2487433
Genome map
AA seq 385 aa AA seqDB search
MLEITEGSHAVAEAVRLCRPQVVSAYPITPQTHIVEALADFVANGKLDAEYITVENELSA
LSACVGASAAGSRAYSATTSQGLMLMAEVVFNAAGMRLPIVMSIANRAMGAPLSIWNDMQ
DSISLRDAGWLHFYAEDNQEATDLHFLAFKVAEDPSVQLPVFVCFDGFILSHTYEPVDIL
TQEQADKFLPAFAPAEKLDAKDPISFGMYATPEYYLEFRYETNEAQKRAKDAIVKYGKEF
GALFGRDYSAFIESYRLDDAETAIVAMGSMCGTIKDAIDEMRDDGMKVGLLRIRVFRPFP
IEEVAKALTHVKRIAVLDKNVSLGSRGGATAIEVRDALYGSTIPVKGYILGLGGRDIRKK
DIKEIVSLCEKGIGDQFYGLRKELI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgctggagataaccgagggatcgcacgcggtggctgaagcagtccggctctgtcgcccg
caggtggtctcggcatacccgatcaccccccagacccatatcgtcgaagctctcgcggat
tttgttgccaacgggaagctcgacgccgagtacattactgttgagaacgaactctccgca
ctctctgcctgcgttggtgcaagcgcagcgggttcgcgtgcctactcggcaacaacatcg
cagggcctgatgctgatggccgaggttgttttcaatgctgcgggcatgcgcctccctatc
gtcatgtccatcgcgaaccgtgccatgggcgcaccgctctccatctggaacgacatgcag
gactcaatctccctgcgcgacgcgggctggctccacttctatgctgaggataaccaggag
gcaaccgacctccacttccttgcctttaaagtggcggaagacccctccgtccagctgccg
gtctttgtctgctttgacgggttcatcctctcccacacctatgagccggtggacatcctc
acgcaggaacaggctgacaagttcctgccggcgtttgctccggccgagaagctggatgca
aaagaccccatcagtttcggcatgtatgcgacaccggaatattatctcgaattccgctac
gagacgaacgaagcccagaaacgggctaaggacgcaatcgtaaagtacggaaaagagttt
ggtgcgctctttggcagggattacagcgcgttcatcgaatcgtaccggctcgatgatgcc
gagaccgcaatcgtagcgatgggctccatgtgcgggacgatcaaggatgccattgacgag
atgcgggatgacggtatgaaggtcgggctcctgcggatccgggtcttccgcccgttcccg
attgaagaggttgccaaagcgcttacccacgtgaagcgcattgcagtgcttgacaagaac
gtctcgcttggctcccggggaggagcaacagcaatcgaggtccgtgatgcactgtacggc
tccacgataccggtaaaaggctacatcctcgggcttggcggccgcgatatccgcaagaag
gacatcaaggagatcgtgagtctctgcgagaaagggatcggcgaccagttctacgggctg
cgcaaggagttgatctga

DBGET integrated database retrieval system