KEGG   Microbacterium foliorum: DXT68_11225Help
Entry
DXT68_11225       CDS       T05657                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mfol  Microbacterium foliorum
Pathway
mfol03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mfol00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    DXT68_11225
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mfol03400]
    DXT68_11225
Enzymes [BR:mfol01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DXT68_11225
DNA repair and recombination proteins [BR:mfol03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     DXT68_11225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AXL12647
UniProt: A0A0F0KV57
LinkDB All DBs
Position
2376129..2378108
Genome map
AA seq 659 aa AA seqDB search
MVAEAQNVQIDGRRLRVTNLDKVVYPQTGTTKGEIIAYYTAIAPHLLPLLEGRPVTRKRW
VEGVGTADHPADSFFTKQLEPGAPEWIPRREIRHSEGPKEYPLVDDVPTLVWLAQVAAIE
LHVPQWRFAHDGSPGNPDRLVLDLDPGPGVGLAQCSEVARIARALLADIGLDPVPVTSGS
KGIHLYAALPGAQTSDEISAVVKEVARLIETEHPDLATSTMAKAARGGKVFLDWSQNNGR
KTTISPYSMRGRAQPWVAAPRTWDELEDPDLAQLDFATVMERAASGVDPIAALRPNPASS
ATAADKSASDRPVTAERLAPARHRARLSAAASAPASAAPASVSPMLAENGTPAIARGLSS
PSWVEVKWDGIRAIGTWADGRMLLHARSGTDITARYPELTADGAPFLPVGDAIVDGEIVA
FDRQGRPSFSLLQNRMHLTRPREIEREVVRTPIVFMVFDLLRLDGHDLSAMPLSQRRTLL
DDVIADLDAPVQVPPVFDDVDAALAASAEFGLEGVVVKDPASRYRPGQRSPSWLKLKHTR
TQEVVIVGIRPGRGDREATFGSLLLAVPDAGDLRYVGRVGTGFSDRMLRDLLARLAPLRI
DAAPLDGVPALDASDALWVEPEVVGEVEFANWTPDGVLRHSRWRGLRPDKSPAEVVVES
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggttgcggaggcgcagaacgtgcagatcgacgggcgtcgactgcgcgtcaccaacctc
gacaaggtcgtgtacccccagaccggcaccaccaagggcgagatcatcgcctactacacg
gcgatcgcgccgcatctgctcccgctgctcgagggccgtccggtcacacgcaagcgctgg
gtcgagggcgtcgggaccgcggatcaccccgcagactccttcttcacgaagcagctcgag
ccgggggcgcccgaatggatcccgcggcgggagatccgccattcggagggccccaaggaa
tatccgctggtcgacgacgtgccgaccctcgtctggctcgcgcaggtcgccgcgatcgag
ctgcatgtgccgcagtggcgttttgcgcacgacggttcgccggggaaccccgaccgcctc
gtgctcgacctcgaccccggcccgggcgtcggcctcgcccagtgctccgaagtggcccgc
atcgcccgtgcactgctcgccgacatcggtctcgaccctgtgcccgtcaccagcggcagc
aagggcatccacctctacgccgccctgcccggtgcgcagaccagcgacgagatctccgcc
gtcgtcaaggaagtcgcccgtctcatcgagaccgagcaccccgacctcgccacgagcacc
atggccaaggccgcccgaggcggcaaggtgttcctcgactggagccagaacaacggcagg
aagaccaccatctcgccctactcgatgcgcgggcgcgcacagccgtgggtggccgcgccc
cgcacctgggacgagctcgaggaccccgacctcgcgcagctcgacttcgcgacggtgatg
gagcgggccgcatcgggcgtggatccgatcgccgcgctgcgcccgaacccggcctcgagc
gcgacggctgcggacaagtccgcatccgatcgacccgtcaccgccgagcgactggctccg
gcccgtcaccgcgcgagactgtccgcggccgcgagtgcgccggcatccgctgctccggcc
tcggtgtccccgatgctcgcggagaacggcacgccggcgatcgcccgcggcctcagctca
ccctcctgggtggaggtgaagtgggacggcatccgagcgatcggcacgtgggccgacgga
cggatgctgctgcacgcccgcagcggcaccgacatcaccgcccgatatcccgagctcacc
gccgacggcgcacccttcctccccgtcggcgacgcgatcgtcgacggcgagatcgtggcg
ttcgaccgacagggtcgccccagcttctcgctgctgcagaaccggatgcacctgacgcgt
ccccgcgagatcgaacgcgaagtggtgcgcacgccgatcgtgttcatggtcttcgatctg
cttcgtctcgacgggcatgacctcagcgcgatgcctctttcccagcggcgcaccctgctc
gacgacgtgatcgccgacctcgatgcgcccgtgcaggtgccgccggtgttcgacgacgtc
gatgccgcactcgcggccagcgcggagttcggtctggagggtgtcgtggtcaaggatccc
gcctcccggtaccggccggggcagcgctccccctcctggctcaagctcaagcacacccgc
acgcaggaggtcgtgatcgtcggcatccgcccgggcagaggtgaccgcgaggcgaccttc
ggctccctgctgctcgccgtgcccgatgccggcgacctccgctatgtcgggcgcgtgggc
acgggtttcagcgaccggatgctgcgagacctgctcgcccggctcgcaccgctgcgcatc
gatgcggcaccgctcgacggcgtgcccgcactcgacgcgtccgacgcgctgtgggtggag
cccgaggtggtcggcgaggtcgagttcgcgaactggacgcctgacggcgtgctccgccac
tcccgttggcgcgggcttcgtcccgacaagtcgcccgccgaggtcgtcgtcgagagctga

DBGET integrated database retrieval system