KEGG   Methanocaldococcus sp. FS406-22: MFS40622_1324Help
Entry
MFS40622_1324     CDS       T01175                                 

Definition
(GenBank) metal dependent phosphohydrolase
  KO
K17487  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase [EC:3.1.4.56]
Organism
mfs  Methanocaldococcus sp. FS406-22
Pathway
mfs00790  Folate biosynthesis
mfs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MFS40622_1324
Enzymes [BR:mfs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.56  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase
     MFS40622_1324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD TraI_2 HD_2
Motif
Other DBs
NCBI-ProteinID: ADC70001
UniProt: D3S587
LinkDB All DBs
Position
complement(1307361..1308110)
Genome map
AA seq 249 aa AA seqDB search
MERLIKLAEQIKDEELRKKVIEFLKNPKATHPGIVDTGISVEEAPASINWHHRYEGGLIE
HTISVTKMALKMADVLEEVYGVEVNRDYIIAGALLHDIMKPYNYIRKEDGTFDHYDMFNL
DHLTLAVAELYKRDFPIEVIKIVASHHGDHSPTRPNSIEAYIVHYADEADSKINDVAVRV
CQARSRDLGVSEQEIYKAVNPLKVYEVRSREGKMKTIEFLKDILKSIGIISEDEKKEESN
ESLENKESN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggagaggttgataaaacttgcagagcaaataaaggatgaagagttaagaaaaaaggtt
attgaatttttaaaaaatcctaaggcaacacatccagggattgtagatactggaattagt
gttgaagaagctccagcaagtataaattggcatcatagatatgaaggtggcttaatagag
catacaatatcagtaacaaagatggctttaaagatggctgatgttttggaggaggtttat
ggcgttgaggttaatagggattatataatcgctggagctctattacatgatataatgaaa
ccctacaactatataagaaaagaagacggcacttttgaccactatgatatgtttaactta
gaccatctaacattagctgttgctgagctctacaaaagagattttccaattgaggttata
aagatagttgcctctcatcatggagaccattctccaacaagaccaaactctatagaggca
tatatagttcattacgctgatgaggcagattcaaagattaacgatgttgctgtgagagtt
tgtcaggcaagaagtagagatttgggagtttctgaacaagagatatataaagcagttaat
cctttgaaggtttatgaagttagaagtagagaaggaaaaatgaaaactatagaattttta
aaagatattttaaaatctattggaataatttctgaagatgagaaaaaagaggaaagtaat
gaaagtttagagaataaggaatctaattaa

DBGET integrated database retrieval system