KEGG   Methanocaldococcus sp. FS406-22: MFS40622_1683Help
Entry
MFS40622_1683     CDS       T01175                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mfs  Methanocaldococcus sp. FS406-22
Brite
KEGG Orthology (KO) [BR:mfs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MFS40622_1683
Enzymes [BR:mfs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MFS40622_1683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lig_C RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ADC70354
UniProt: D3S690
LinkDB All DBs
Position
complement(1635238..1636413)
Genome map
AA seq 391 aa AA seqDB search
MMKVLTYDLNKIAEKLNLSIKDLNKAFNKKILREDEYKETKTLLFKKEFKGVEKGTVIFL
NDNLDVVRGYPKTYRAITLYPTIKKHFIDKVVIEEKLNGYNIRIVKIDGEVYALTRSGYI
CPFTTKKVKKFLNLEILDDYSEYMLCGEMIGLNNPYTPYYYKEVDRGYENLGFYIFDIKE
RETNKSLPIKERINLCEKYNLPYVKPLAIVDKDNAHIHVRKIIEKLNEEGREGVVLKDPD
MAVPPIKYTTHYTQCEDLKSAFTFFFDLGMDFLFSRVVREGFMSYEFKECEEERKKRAKD
LGEAILLPMVETINKIADGERISEDFELIFDSEDDFEEFLDFMRKMKMVITIKNVEEINT
NEGVKIKVLIGKIYNKTNDKVISYLNGTLWE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaggtcttaacatatgacttaaataaaatagcggaaaaactcaatttatctata
aaagatttaaataaagcatttaacaagaaaattttaagagaagatgaatataaagaaaca
aaaacattactatttaaaaaagaatttaaaggggtagagaaagggacagttatatttcta
aacgataacctcgatgttgttaggggatatccaaaaacatacagggctataaccctatac
ccaacaataaaaaaacatttcattgataaggttgttattgaagagaaactgaacggctat
aacataagaatcgttaaaatagatggagaagtttatgctttaacaagaagtggttatatc
tgcccctttacaacaaaaaaggttaaaaaattcttaaatttggaaattttagatgactac
agtgagtatatgttatgtggagaaatgattggtctaaacaacccctacacaccttattat
tataaagaggttgatagaggttatgaaaatctcggattttatatatttgatataaaagag
agggagacaaacaaatcgctaccaataaaagagaggataaatctatgtgagaaatataac
ttaccttatgttaagccgttggcaattgtcgataaggataatgcccatatacacgtaagg
aagattattgaaaagctaaacgaagaagggagagagggagttgttttaaaagacccagat
atggctgttcctccaataaaatatacaactcactatactcagtgtgaagacttaaaatca
gcctttacatttttctttgatttgggaatggactttttatttagtagggttgtgagagaa
ggatttatgagctatgagtttaaagagtgtgaagaggagagaaaaaagagggctaaagat
ttgggagaggcaattttgttgccaatggttgagacaattaataaaatagctgatggagag
aggatttctgaggattttgagctaatatttgatagtgaagatgattttgaggagttttta
gattttatgagaaagatgaaaatggttataacaataaaaaatgttgaagagattaatacc
aacgaaggagttaaaattaaggtgttgattggaaaaatatacaacaaaactaacgataaa
gttataagttatttaaatggaacactttgggaataa

DBGET integrated database retrieval system