KEGG   Mycolicibacterium fortuitum: XA26_00220Help
Entry
XA26_00220        CDS       T04105                                 

Definition
(GenBank) Serine/threonine-protein kinase PknA
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mft  Mycolicibacterium fortuitum
Brite
KEGG Orthology (KO) [BR:mft00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mft01001]
    XA26_00220
Enzymes [BR:mft01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     XA26_00220
Protein kinases [BR:mft01001]
 Serine/threonine kinases: Other
  Bacterial family
   XA26_00220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Pkinase_fungal Kinase-like Haspin_kinase RIO1 ABC1
Motif
Other DBs
NCBI-ProteinID: ALI23889
UniProt: A0A0N9Y3Q4
LinkDB All DBs
Position
complement(20109..21338)
Genome map
AA seq 409 aa AA seqDB search
MQRLIATGGMGQVWEAVDSRLGRRVAVKVLKAEFSTDAEFVERFRAEARTVAMLNHPGIA
SVYDYGETELDGEGRTAYLVMELINGEPLNSVLKRTGRLSLRHALDMLEQTGRALQVAHT
AGLVHRDVKPGNILITPTGQVKLTDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDA
TAASDVYSLGVVGYESVSGKRPFTGDGALTVAMKHIKETPPPLPADLPPNVRELIEITLV
KNPGMRYKSGGPFADAVAAVRSGRRPPRPNQAPTLGRAAPAAVPSAAQARAAADLSGRTP
VTATRARPTAAAHRPAPAPRRTFSSGQRALLWAAGVLGALAIVIAILIVLNAQDRKDQQQ
SPPPTVTDTVTQTTPYQTPAALPDLAFHVIVPEGTAAQVVPKAPEQILR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
ttgcagcggctgatcgccacgggcggcatgggtcaggtctgggaggccgtcgactcccgg
ctgggccgtcgggtcgcggtgaaggtgctcaaggctgagttctcgaccgatgccgagttc
gtcgagcggttccgggccgaggcccgcacggtggccatgctcaaccatccgggcatcgcc
agcgtctacgactatggcgagaccgagctggacggcgagggtcgcaccgcctacctggtg
atggagctgatcaacggcgagccgttgaactcggtgctcaagcgcaccggccggttgtcg
ctgcggcacgccctggacatgctcgagcagaccgggcgcgcactgcaggtcgcgcacacc
gcgggcctggtgcaccgcgacgtcaaaccgggcaacatcctgatcaccccgaccggccag
gtgaagctgaccgacttcggtatcgccaaggccgtcgacgccgcgccggtcacccagacc
ggcatggtgatgggcactgcccagtacatcgcgcccgagcaggccctgggccatgacgcg
accgccgccagcgacgtctattcgctgggagtcgtcggctacgaatcggtctcgggcaag
cgcccgttcaccggcgacggcgcgcttacggtcgcgatgaagcacatcaaggagacccct
ccgccgctgcccgccgatctgccgcccaacgtgcgcgaactgatcgagatcaccctggtg
aagaacccggggatgcggtacaagtccggcggcccgttcgccgatgcggtcgccgcggtg
cgctcgggacgccgtcctccgcgccccaaccaggccccgacgctcggtcgggctgcaccg
gccgcggtcccgtcggctgcccaggcccgcgctgcagcggatctgtccggccgcacaccg
gtgaccgccacccgggccaggcccaccgccgccgcgcaccggcccgctccggcccctcga
cgcacgttctcgtcgggtcaacgggctctcctgtgggcggccggggtgctcggcgcgctc
gcgatcgtgatcgccatcctcattgtcctcaatgcgcaggaccgcaaggatcaacagcag
tcgccaccgcccacggtcaccgacacggtgacccagacgacgccctaccagacgccggca
gcgttgccggatctggctttccacgtgatcgtgcccgaaggaaccgccgctcaggttgtc
ccgaaggcaccggaacagatactgcgatga

DBGET integrated database retrieval system