KEGG   Mycolicibacterium fortuitum: XA26_02710Help
Entry
XA26_02710        CDS       T04105                                 

Definition
(GenBank) Aldehyde dehydrogenase
Organism
mft  Mycolicibacterium fortuitum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ALI24137
UniProt: A0A0N9Y3S0
LinkDB All DBs
Position
274222..275682
Genome map
AA seq 486 aa AA seqDB search
MDQHLGEYLGIEADWSLEGDDAHAVEVISPHTEQPIARVVAAGPAEVDAAVAAARAAIDH
GPWPRLDPAERIAAVRRLAEIYAGRRGEMAQLISAEMGAPISFAQRAQVGLPAMMMSAFC
DLAETHPWHETRTGFFGSDVRIQKQPVGVVAAIVPWNMPQFLIVTKLVPALLAGCAVVLK
PAPESPLDAALLSDMLKEVGLPDDVVSVIQGDAGVGARLVGHPGVDKVSFTGSSAAGRAV
AAAAAANLTKVSLELGGKSAAIILDDADPDTVAAGVRSASLSNSGQICNALTRIVVPAAR
EREYVDALADRMNALIVGDPADPATELGPLVSRRQQQRVRDYIDLGRNEGARMVCGGTDL
PDGVDSGWYVRPTLFAGADNSMRIAREEIFGPVLTVIGYRNEDEAIAIANDSDYGLAGSV
WTADTDRGISVAERVQTGTFGVNQGYTMDPFAPFGGIKDSGYGRELGREGLEGYLETKSI
AVATAR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggatcagcatcttggtgagtacctcggcatcgaggcggactggtcgctcgagggcgat
gatgcccacgcggtggaggtgatctccccgcacaccgagcagcccatcgcccgtgtggtg
gcagccggcccggcagaggtggatgcagccgtcgcggcggcgcgggcggctatcgaccac
gggccgtggccgcgtctcgacccggccgaacgcatagcggcggtgcggcgcctcgccgag
atttacgccggtcgacgcggggagatggcacaactcatctcggcagagatgggagcgccc
atcagtttcgcccaacgcgcgcaggtcggccttccggccatgatgatgtccgcgttctgc
gacctcgccgaaacccatccctggcacgagacccgcactggtttcttcggatcggacgta
cgtatccagaagcaaccggtgggcgtcgtcgccgccatcgtgccgtggaacatgccgcag
ttcctcatcgtcaccaagctggtgcccgcgctgctggccgggtgcgcggtggtgctcaag
ccggcccctgaaagcccgctggatgctgcgcttttgagtgacatgctcaaggaggtcggc
ctgcccgacgacgtcgtctccgtcatccagggtgacgccggagtcggcgcccgcctggtc
ggtcatcccggcgtcgacaaggtctcgttcaccggctccagcgcggcaggccgggccgtc
gccgcagcggcagcggccaacctgaccaaggtgagcctcgaactcggaggcaagtcggcg
gccatcatcctcgacgacgccgacccggacacggtggcggccggtgtgcggtcggccagc
ctgtccaacagcggccagatctgcaatgcgctgacccgcatcgtcgtcccggccgcccgg
gagcgcgagtacgtcgacgccctcgccgaccgaatgaacgcactcatcgtcggcgatccc
gccgatcccgccaccgaactggggccactcgtgtcccgacggcagcagcagcgcgtacgg
gactacatcgacctcggccggaacgaaggtgcgcggatggtctgcggtgggaccgacctg
ccggacggcgtagacagcggctggtacgtccggcccacacttttcgccggcgcggacaac
tcgatgcggatcgcccgagaagagatcttcgggcctgtcctcaccgtgatcggctaccgg
aacgaggacgaggccatcgcgatcgccaacgactccgactacggactggccggctcggtc
tggacggccgacaccgaccgcgggatcagcgtcgccgagcgtgtacaaaccggaactttc
ggggtaaaccagggatacacaatggatccgttcgcaccgttcggcggcatcaaggacagc
ggatacggccgggaactcggccgcgaaggccttgagggctatctcgaaaccaagtccata
gccgtcgcaaccgcacgttga

DBGET integrated database retrieval system