KEGG   Mycolicibacterium fortuitum: XA26_02890Help
Entry
XA26_02890        CDS       T04105                                 

Definition
(GenBank) putative methyltransferase
Organism
mft  Mycolicibacterium fortuitum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: ALI24155
UniProt: A0A0N9XL33
LinkDB All DBs
Position
complement(290662..291435)
Genome map
AA seq 257 aa AA seqDB search
MQPSDILSRFARRATLSRSVRLLAQFRFEQSEPARFYGALADDTVAMTTDLWMSATGEST
AGRTVLDVGGGPGYFASAFDGAGMRYIGVEPDPAEMHAGPAADATEGTFVRASGMALPFA
DDSVDICLSSNVAEHVPHPWRLGNEMLRVTKPGGLVVLSYTVWLGPFGGHEMGLTHYLGG
VRAAERYTRKHGHRPKNDYGSSLFAVSAADGLQWAASTGALIAAFPRYHPRWAWWMTSAP
GLREFLVSNLVLVLRPS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcccagcgacatcttgagccgcttcgcccgccgggcaaccttgagccggtcggtc
cgcctgctcgctcaattccggttcgagcagagcgaaccggctcggttctacggcgcattg
gccgacgacaccgtcgccatgaccaccgatctgtggatgtcggcgaccggcgagagcacg
gccggacgcaccgtgctcgacgtcggcggaggcccgggttacttcgcctcggcattcgac
ggggcgggcatgcgctacatcggagtggagccggatccggccgaaatgcacgcgggacca
gcagcggacgcgacggagggcactttcgtccgggcctccggcatggctctgcccttcgcc
gacgacagcgtcgacatctgcctgtcctcgaatgttgccgagcatgtaccgcatccgtgg
cgactgggcaacgagatgctgcgggtgacgaaaccgggcgggctggtcgtgttgtcgtac
accgtctggctcggtccgttcggcggtcacgagatggggctgacgcactatctgggcggg
gtccgcgcggccgagcggtacacccgcaaacacggccaccgacccaagaacgactacggc
tcgtcgttgttcgccgtgtcagccgccgacggtctgcagtgggcggccagcaccggcgcg
ctgatcgctgcatttccccgctaccacccacgatgggcgtggtggatgacctcggcgcct
gggttgcgggagttcctggtgagcaatctggtgttggtcctgaggccgtcctga

DBGET integrated database retrieval system