KEGG   Mycolicibacterium fortuitum: XA26_05200Help
Entry
XA26_05200        CDS       T04105                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft00250  Alanine, aspartate and glutamate metabolism
mft00280  Valine, leucine and isoleucine degradation
mft00310  Lysine degradation
mft00410  beta-Alanine metabolism
mft00640  Propanoate metabolism
mft00650  Butanoate metabolism
mft01100  Metabolic pathways
mft01120  Microbial metabolism in diverse environments
Module
mft_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    XA26_05200
   00650 Butanoate metabolism
    XA26_05200
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XA26_05200
   00280 Valine, leucine and isoleucine degradation
    XA26_05200
   00310 Lysine degradation
    XA26_05200
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XA26_05200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mft01007]
    XA26_05200
Enzymes [BR:mft01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     XA26_05200
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     XA26_05200
    2.6.1.48  5-aminovalerate transaminase
     XA26_05200
Amino acid related enzymes [BR:mft01007]
 Aminotransferase (transaminase)
  Class III
   XA26_05200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALI24381
UniProt: A0A0N9X7L8
LinkDB All DBs
Position
526186..527532
Genome map
AA seq 448 aa AA seqDB search
MTIAEITGAAIAQERRLVTAIPGPLSQEMQARKTAAVAGGVGTTLPVYVVAAGGGILVDA
DGNQLIDFGSGIAVTTVGNSAPAVVDAVTQQVAAFTHTCFMVTPYEGYVRVAEELNRLTP
GDHEKRSVLFNSGAEAVENAVKIARAYTRRQAVVVFDHAYHGRTNLTMAMTAKNQPYKNG
FGPFAGEVYRVPTSFPFRDGETDGAAAAARALDLIDKQVGAENVAAVVIEPIQGEGGFIV
PAPGFLSALQDWCTEAGAVFVADEVQSGFARTGAMFAVEHDGVVPDLIVTAKGIAGGLPL
SAVTGRAEIMDAPHAGGLGGTYGGNPIACAAALAVIDTIEREGLLARAVEIEKTMIGRLS
AIAAEDSRIGEVRGRGAMIAVELVKAGTSVPDADLAKQVSAAAHAQGLVVLTCGTYGNVL
RFLPPLSMPDHLLVEGLDILAGIFAETR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgccgagatcacgggtgcggccatcgctcaggaacgccggctcgtcaccgcc
attccgggcccgctctcgcaggagatgcaggcacggaaaaccgctgcggtggccggtgga
gtcgggaccaccctgcccgtctacgtggtggccgcaggcggcggaatcctcgtcgacgcc
gacggtaaccagctcatcgacttcggctccggcatcgccgtgaccaccgtgggcaacagc
gcgcccgccgtcgtggacgcggtcacccagcaggtcgccgcgttcacccacacctgcttc
atggtgacgccttacgagggctacgtgcgggttgccgaggagctcaaccggctcaccccg
ggtgaccatgagaagcgcagcgtgctgttcaactccggcgccgaagccgtcgagaacgct
gtgaagatcgcccgggcctacacccgcaggcaggccgtcgtcgtgttcgaccacgcctac
cacggccgcaccaacctgaccatggcgatgaccgccaagaaccagccgtataagaacggg
ttcgggccgttcgccggtgaggtgtaccgcgtgcccacgtcgttcccgttccgtgacggc
gagaccgacggagccgccgcggccgctcgcgccctcgacctgatcgacaagcaggtcggt
gccgaaaacgtggccgccgtggtgatcgagccgatccagggtgagggtggattcatcgtt
cccgcaccgggattcctgagcgcgctgcaggactggtgcaccgaggccggcgcggtcttc
gtcgccgacgaggtgcagtcgggcttcgcccgcaccggtgccatgttcgctgtcgagcac
gacggcgtcgtacccgatctgatcgtcaccgccaagggcatcgccggcggactgccgctg
tcggcggtcaccggccgcgccgagatcatggacgcaccgcatgccggcggcctcggtggt
acctacggcggtaacccgatcgcgtgtgcggctgcgctcgcagtcatcgacaccatcgag
cgcgagggcctgctcgcccgtgccgtggagatcgagaagaccatgatcggccggctcagc
gcgatcgcggccgaggattcccggatcggtgaggttcgtggccgtggcgccatgatcgcc
gtcgaactggtcaaggcgggcacgtccgtgcccgatgccgatctggccaagcaggtttcg
gcagccgcgcacgcccagggcctggtggtcctgacctgcggcacctacggcaatgtgctg
cggttcctgccgccgctttcgatgcccgatcacctcctcgtggaggggctcgacatcctg
gccggcatcttcgccgagacccgctag

DBGET integrated database retrieval system