KEGG   Mycolicibacterium fortuitum: XA26_06330Help
Entry
XA26_06330        CDS       T04105                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft00220  Arginine biosynthesis
mft00250  Alanine, aspartate and glutamate metabolism
mft00290  Valine, leucine and isoleucine biosynthesis
mft01100  Metabolic pathways
mft01110  Biosynthesis of secondary metabolites
mft01130  Biosynthesis of antibiotics
mft01210  2-Oxocarboxylic acid metabolism
mft01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mft00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XA26_06330
   00290 Valine, leucine and isoleucine biosynthesis
    XA26_06330
   00220 Arginine biosynthesis
    XA26_06330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mft01007]
    XA26_06330
Enzymes [BR:mft01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     XA26_06330
    2.6.1.66  valine---pyruvate transaminase
     XA26_06330
Amino acid related enzymes [BR:mft01007]
 Aminotransferase (transaminase)
  Class I
   XA26_06330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ALI24493
UniProt: A0A0N9XBB8
LinkDB All DBs
Position
complement(649746..651017)
Genome map
AA seq 423 aa AA seqDB search
MVSVTTHQLPWQTGQHPKPRTFAQSTKLQDVLYEIRGPVHEQASRLEAEGHRILKLNIGN
PAPFGFEAPDVIMRDMIQALPYAQGYSDSKGIASARRAVFTRYELVEGFPKFDIEDVYLG
NGVSELITMTLQALLDNGDQVLIPAPDYPLWTASTALAGGTPVHYMCDETQGWNPDVADI
ESKITERTKALVVINPNNPTGAVYSRETLEQMVELARKHQLLLLADEIYDKILYDDAKHI
SLATLAPDLLCLTFNGLSKAYRVAGYRSGWLVITGPKEHATSFIEGISLLSNMRLCPNVP
AQHAIQVALGGHQSIDDLVLPGGRLLEQRDTAWTKLNEIPGVSCVKPAGALYAFPRLDPE
VHDIHDDEQLVLDLLLQEKILLTQGTGFNWPTPDHLRIVTLPWARDLAQAIERLGNFLAG
YRQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcgtgactacccatcagttgccgtggcagaccggtcagcacccgaagccgcgt
acgttcgcccagtccacgaagctgcaggacgtcctgtacgagatccgtggaccggtacac
gagcaggcctcacggctggaagctgaagggcaccgcatcctcaagctcaacatcggcaac
cccgcgccgttcggcttcgaggcgcccgacgtgatcatgcgcgacatgatccaggccctg
ccgtacgcgcagggctattccgactccaagggcatcgccagcgcgcgtcgcgcagtgttc
actcgctacgagctggtcgagggtttccccaagttcgacatcgaagacgtctacctgggc
aacggcgtctcagagctcatcacgatgaccctgcaggcgctgctcgacaacggcgatcag
gtgctcatcccggcgccggactaccccctgtggacggcgtcgaccgccctggccggcggc
accccggtgcattacatgtgcgacgagacccaaggctggaatcccgatgtcgccgacatc
gagtccaagatcaccgaacgcaccaaggcgctggtcgtgatcaacccgaacaaccccacc
ggcgcggtctacagccgcgaaactctggaacagatggtggagttggcccgtaagcaccag
ctgttgctgttggccgacgagatctacgacaagatcctctacgacgacgccaagcacatc
tcgctggcgacattggcgcccgaccttctgtgcctgactttcaacgggctgtccaaggcc
taccgggtcgccggctaccgctcgggctggttggtcatcaccggccccaaggaacacgcg
accagcttcatcgagggcatcagcctgctgtcgaatatgcggttgtgcccgaatgtgcct
gcgcagcacgcgattcaggtggccctgggcggccatcagagcatcgacgatctcgtgttg
ccgggtggccggctgctcgagcagcgtgacaccgcgtggaccaaactcaacgagatcccc
ggtgtctcgtgtgtgaaacccgcgggagcgctgtacgcgttcccgcgcctcgaccccgaa
gtgcacgacatccacgatgacgagcagctggtgctcgacctgctgttgcaggagaagatc
ctgttgacgcagggcacgggattcaactggcccacaccggatcacctgcgcatcgtcaca
ctgccgtgggcgcgcgacctggcccaggccatcgagcggctgggcaatttcctggccggc
taccggcagtaa

DBGET integrated database retrieval system