KEGG   Mycolicibacterium fortuitum: XA26_15950Help
Entry
XA26_15950        CDS       T04105                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft00473  D-Alanine metabolism
mft01100  Metabolic pathways
mft01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mft00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    XA26_15950
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    XA26_15950
Enzymes [BR:mft01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     XA26_15950
Peptidoglycan biosynthesis and degradation proteins [BR:mft01011]
 Precursor biosynthesis
  Racemase
   XA26_15950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALI25442
UniProt: A0A0N9XDN6
LinkDB All DBs
Position
1630409..1631578
Genome map
AA seq 389 aa AA seqDB search
MQTTERETSLIPHASPQAVVDLGAIDHNVRLLRQHAGDARVMAVVKADAYGHGAVEVGKA
ALAAGAAELGVVTVAEAVALRAGGITAPVLCWLHPPGTDFTPALENDVQIAVSSARQLDD
VLTAVRRTGRSATITVKVDTGLSRNGVSPADFPAMVTALGRAQADGEIRVRGIMSHLVHG
DDPDNPFNELQGKRLTAMREQAAEHGVVFEVAHIANSPAAMTRPDLAFDMVRPGIAVYGL
SPIPERGDMGLIPAMTLKCPVALVRSIHAGDGVSYGHRWIADRDTMLALLPVGYADGIFR
SLSGRIEVLIKGRRRQAVGRICMDQFVVDLGPDAADVAEGDEAILFGPGTSGEQTAQDWA
ELLGTINYEVVTSPRGRITRSYVQAGRER
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgaccgaacgcgagacatcgctgatcccgcacgcatcgccgcaggcggtggtg
gatctcggcgccatcgaccacaacgtccgcctgctgcgtcaacatgccggtgacgcgcgg
gtgatggccgtggtcaaggccgacgcgtacggacacggcgccgtcgaggtgggcaaggcc
gcactggccgccggtgccgccgaactcggggtggtgacggtcgccgaggcagtcgcactg
cgagccggaggcatcactgccccggtgctgtgctggctgcatccgccgggcaccgatttc
acgccggcgctggaaaacgatgtacagatcgcggtgtcctcggcgcgccagctcgacgac
gtgctgacggctgtacgccggacgggtcggagcgcgaccatcacggtgaaggtcgacacc
ggcctgagccgcaacggcgtgagtccggccgactttcccgcgatggtcacggcgctcggc
cgcgctcaagccgacggggagatccgggtgcgcggcatcatgagtcatctggtgcacggc
gacgatcccgacaacccgttcaacgagctgcagggcaaacgcctgaccgcgatgcgcgag
caggccgccgagcacggtgtggtgttcgaggtggcgcacatcgccaactcgcccgctgcg
atgacgcgtccggatctggctttcgacatggtccggcccggtatcgcggtctacgggctc
agccccatcccggaacgcggcgacatgggactgatccccgccatgacattgaaatgccct
gttgcactggtccgttcgattcatgccggtgacggggtgtcctatggtcaccggtggatc
gcggaccgggacaccatgctggcgttgctgccggtgggctacgcagacggcatcttccgc
tcgttgagcgggcggatcgaggtgctgatcaagggcagacgtcgacaggccgtcgggcgg
atctgcatggatcagttcgtcgtcgatctcggtccggatgccgccgacgtggccgaaggt
gacgaagcgatcctgttcgggcccggcacatccggtgaacagaccgcccaggactgggcc
gaactgctcggcaccatcaactacgaagtggtcaccagcccgcggggacggatcacccgc
agctacgtgcaggcaggtcgcgagcgttga

DBGET integrated database retrieval system