KEGG   Mycolicibacterium fortuitum: XA26_23740Help
Entry
XA26_23740        CDS       T04105                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft00473  D-Alanine metabolism
mft00550  Peptidoglycan biosynthesis
mft01100  Metabolic pathways
mft01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mft00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    XA26_23740
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XA26_23740
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    XA26_23740
Enzymes [BR:mft01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     XA26_23740
Peptidoglycan biosynthesis and degradation proteins [BR:mft01011]
 Precursor biosynthesis
  Amino acid ligase
   XA26_23740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 RimK CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ALI26217
UniProt: A0A0N9Y8L8
LinkDB All DBs
Position
2402404..2403525
Genome map
AA seq 373 aa AA seqDB search
MTARNGTGSRTRVAVVYGGRSSEHAISCVSAGSILRNLDPERYEVVAVGITPDGSWMLTD
GSPETLAITDGRLPEVTETSGTELALPAAPNRSGQLLALSNGPGELLAAVDVVFPVLHGP
YGEDGTIQGLLELAGIPYVGSGVLSSAAGMDKEFTKKLLVAEGLPIGDFVVLRPNRPTMD
LEQRERLGLPVFVKPARGGSSIGVSRVSAWDELPAAIELARRHDPKVIVEAAIPGRELEC
GVLEFPDGRVEASTLGEIRVAGVRGREDGFYDFATKYLVDAAELDVPAKVDDDVSEEIRR
LAVRAFTAIDCQGLARVDFFLTDDGPVINEINTMPGFTTISMFPRMWAASGVDYPTLLTA
MVETALARGTGLR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcccgcaatgggaccggatcccgcacccgcgtcgccgtcgtctacggcgggcgt
agctctgagcacgctatttcctgcgtatcggcaggcagcatcctgcgcaacctcgacccg
gagcggtacgaggtcgtggccgtcgggatcacccccgacggctcctggatgctgaccgac
ggaagccccgagacgctcgccatcaccgacggccggctgccggaggtcaccgagacatcc
ggcaccgagctcgcgctgcctgccgccccgaaccgcagcggccagctgctggcgctgagc
aacggccccggtgagcttttggcggccgtggacgtggtcttcccggtgttgcacggccct
tacggcgaggacgggaccatccaggggctgctggagctggccggtatcccgtacgtgggc
tccggcgtgctgtccagcgccgcaggtatggacaaggagttcaccaagaagctgcttgtc
gccgagggcctgccgatcggtgatttcgtggtgctgcgccccaaccgtccgacgatggat
ctggagcagcgcgaacgcctcggcctgccggtgttcgtcaaaccggcccggggtggctcg
tcgatcggcgtcagccgggtctcggcgtgggatgaactgcctgccgcaatcgaacttgcg
cgtcgccatgacccgaaggtcatcgtcgaggcagcgattcccggtcgggaattggagtgc
ggcgtactcgaattcccggacggtcgggtcgaggccagcacgctgggcgagatcagggtg
gcaggcgtgcgcgggcgtgaggacggcttctacgacttcgccaccaaatacctcgtcgac
gcagccgaactggacgtgccggccaaggtcgacgacgacgtgtcggaggagatccgccgg
ttggcggtgcgtgccttcactgcgatcgactgccaggggctggcccgtgtcgacttcttc
ctgaccgacgacgggccggtgatcaacgagatcaacacgatgcccgggttcaccaccatc
tcgatgttcccccggatgtgggcggccagcggcgtcgactacccgacattgctgaccgcg
atggtcgagaccgcgctggcgcggggtaccgggctgcgctga

DBGET integrated database retrieval system