KEGG   Mycolicibacterium fortuitum: XA26_27860Help
Entry
XA26_27860        CDS       T04105                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mft  Mycolicibacterium fortuitum
Pathway
mft00250  Alanine, aspartate and glutamate metabolism
mft00280  Valine, leucine and isoleucine degradation
mft00310  Lysine degradation
mft00410  beta-Alanine metabolism
mft00640  Propanoate metabolism
mft00650  Butanoate metabolism
mft01100  Metabolic pathways
mft01120  Microbial metabolism in diverse environments
Module
mft_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mft00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    XA26_27860
   00650 Butanoate metabolism
    XA26_27860
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XA26_27860
   00280 Valine, leucine and isoleucine degradation
    XA26_27860
   00310 Lysine degradation
    XA26_27860
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XA26_27860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mft01007]
    XA26_27860
Enzymes [BR:mft01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     XA26_27860
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     XA26_27860
    2.6.1.48  5-aminovalerate transaminase
     XA26_27860
Amino acid related enzymes [BR:mft01007]
 Aminotransferase (transaminase)
  Class III
   XA26_27860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ALI26621
UniProt: A0A0N9XD69
LinkDB All DBs
Position
complement(2797359..2798702)
Genome map
AA seq 447 aa AA seqDB search
MLSHPEQSRHLATTIPGPKSQALIARKSAAVARGVGNTMPVYAVRAGGGIVEDADGNRLI
DLGSGIAVTTIGNSSPRVVEAVATQAAEFTHTCFMVTPYEQYVAVCEHLNRLTPVRGDKR
SALFNSGSEAVENAVKIARSHTHKPAVVAFDHAYHGRTNLTMALTAKAMPYKHGFGPFAP
EIYRAPLSYPYRDAEFGKELATDGALAARRAIDVMEKQIGADNLAAVIIEPIQGEGGFIV
PADGFLPALLGWCRDNDVVFIADEVQTGFARTGAMFACEHEGIDPDLIVTAKGIADGLPL
SAVTGRAEIMDSPHVSGLGGTYGGNPIACAAALATIETIEADGLIARAQHIEQLMKDRLG
RLQAEDERIGDVRGRGAMIAVELVKAGTTTPDPELTKALCAGAHTAGVIVLSCGTYGNVL
RFLPPLTISDELLIEGLDVLELILRDL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgttgagccatcccgagcagagccgccacctggccaccacgattcccgggccgaaatct
caagcgttgatcgcccggaaatcggcggccgtcgcccgcggcgtcggcaacaccatgccc
gtgtacgcggtccgcgccgggggcgggatcgtcgaagacgctgacggcaatcggctcatc
gacctggggtcgggcatcgcggtgaccaccatcggcaactcgtcgccgcgcgtcgtcgaa
gcggtagcgacgcaggccgccgagttcacccatacgtgcttcatggtgacgccgtatgag
cagtacgtcgcggtgtgcgaacacctcaaccggctgacaccggtccgcggggacaagcgt
tcggccttgttcaactccgggtcggaggccgtggagaacgcggtcaagatcgcgcggtcc
cacacccacaagcccgccgtcgtcgccttcgaccacgcctatcacgggcgcaccaacctc
acgatggcgctgaccgccaaggccatgccctacaagcacggcttcggcccgttcgctccg
gagatctaccgagcgccgctgtcctacccgtaccgcgacgccgagttcggcaaggaactg
gccaccgacggcgcactcgcggccaggcgcgccatcgatgtgatggaaaagcagatcggc
gccgacaacttggccgcggtcatcatcgagcccatccagggcgagggcgggttcatcgtc
ccggccgacgggttcctgcctgcgctgctgggttggtgccgcgacaacgacgtggtgttc
atcgccgacgaggtgcagaccgggttcgcccggaccggcgcgatgttcgcatgcgagcac
gagggcatcgaccccgatctgatcgtcaccgccaagggcatcgccgatggcctcccactg
tccgcggtgaccgggcgggccgagatcatggactcgccgcacgtctccggtctgggcggc
acctatggcggcaatccgatcgcgtgcgcggcggcactggccacgatcgagaccatcgag
gccgacggattgatcgcccgcgcccagcacatcgagcagctgatgaaagaccggctgggc
cggttgcaggccgaggacgagcggatcggtgatgtacgtggccggggcgcgatgatcgcc
gtcgaactggtcaaggccggcacgaccacacccgaccctgagctgaccaaggcgctttgc
gccggtgcccatacggccggggtgatcgtgctgtcctgcggaacctacggcaacgtactg
cgcttcctcccgccgctgaccatcagcgacgagctgctgatcgaggggctcgacgtgctc
gagctgatcctgcgcgacctctga

DBGET integrated database retrieval system