KEGG   Mycolicibacterium fortuitum: XA26_56840Help
Entry
XA26_56840        CDS       T04105                                 

Definition
(GenBank) LigC-like protein
Organism
mft  Mycolicibacterium fortuitum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ALI29473
UniProt: A0A0N9YIS3
LinkDB All DBs
Position
complement(5823094..5824143)
Genome map
AA seq 349 aa AA seqDB search
MDLPVVPPIEPMLAKAQVKVPDEAGVWSYEPKWDGFRALAFRDGDEVVLQSRSGKELGRY
FPELLDALRDELADRCVLDGEVVVPREIDGRVRLDWESLSQRIHPAESRVRMLAEQTPAH
FIGFDALATGDRSLLAEPFRVRREALIQAVEAKQWCHVTRTTTDPELGAQWLQTFEGAGL
DGVIAKKLDGPYLPGKREMVKVKHHRDADCVAIGYRIHKSGEGVGSILLGLYRADGELQM
VGGAASFSVKDRLKLLADLEPLREGDEVREGDPSRWNSAADKRWIPVRPERVCEVAYDQM
EGNTDNGRRFRHAVKFMRWRPDREPSSCTFDQLDVPLNYDLYDVLTKEG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtggacctacccgtagtgccgccgatcgaaccgatgcttgccaaagcccaggtgaaagtg
cccgacgaggccggagtgtggtcctatgagccgaagtgggacggcttccgcgcactggcc
ttccgcgacggcgatgaggtggtcctgcagtcgcgcagcgggaaggaactcggacggtac
tttcccgagctgctcgacgcgctgcgcgacgagctcgccgaccgctgcgtcctcgacggt
gaagtggtggtgccacgcgagatcgacggccgcgtgcgcctcgactgggagtcgttgtcc
cagcgcatccaccccgccgagtcgagggtcaggatgctcgccgaacagaccccggcacac
ttcatcgggttcgatgctcttgctaccggggaccggtcgctgcttgccgagccgttccgg
gtgcgccgtgaggcactgatccaagccgtcgaggccaaacaatggtgccatgtcacccgg
accaccaccgatcccgagctcggtgcgcagtggttgcagaccttcgagggcgcaggcctg
gacggggtgatcgccaagaagctcgacggcccttacctgccgggcaagcgggagatggtc
aaggtaaagcatcaccgcgacgccgattgcgtggccatcggctaccgcatccacaagagc
ggtgagggcgtcggctcgatcctgctcggcctctaccgtgctgacggcgagctgcagatg
gtcggtggggcagcatcgttcagcgtcaaggaccggctcaaacttctggccgacctggaa
ccgctgcgtgagggcgatgaagtgcgtgagggggatcccagccggtggaactcggccgcc
gacaaacgctggattccggtgcgcccggagagggtgtgcgaggtggcgtatgaccagatg
gaaggcaataccgacaacggtcggcgcttccgccacgcggtgaagttcatgcgctggcgc
ccggaccgggaaccgtcgagctgcacgttcgaccagctcgacgtgccgttgaactacgac
ctgtacgacgtgctgacgaaggaaggttga

DBGET integrated database retrieval system