KEGG   Mycolicibacterium fortuitum: XA26_58210Help
Entry
XA26_58210        CDS       T04105                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mft  Mycolicibacterium fortuitum
Brite
Enzymes [BR:mft01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     XA26_58210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ALI29606
UniProt: A0A0N9XZE1
LinkDB All DBs
Position
5970274..5970897
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDYDYGALEPHISGQINELHHSKHHAAYVKGVNDAVAKLDEARANGDHAAIF
LNEKNLAFHLGGHVNHSIWWKNLSPNGGDKPTGDLAAAIDDQFGSFDKFQAQFTAAANGL
QGSGWAVLGYDSLGDRLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVKA
FWNVVNWEDVQNRYAAATSKTNGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaatacactttgccggacctggattacgactacggagcactggagccccacatc
tcggggcagatcaacgagctccaccacagcaagcaccacgccgcgtacgtcaagggcgtc
aacgacgccgtggccaagctcgatgaggcgcgggccaacggtgaccacgcggcgatcttc
ctcaacgagaagaacctggcgttccatctcggcggccacgtgaaccactccatctggtgg
aagaacctgtcccccaacggtggtgacaagccgacgggcgatctggccgcggcgatcgac
gaccagttcggctcgttcgacaagttccaggcgcagttcaccgccgccgccaacgggctg
cagggctcgggctgggccgtgctcggctacgacagcctgggcgatcggctgctgaccttc
cagctctacgaccagcaggccaacgtgccgctcggcatcatcccgctgctccaggtcgac
atgtgggagcacgccttctacctgcagtacaagaacgtcaaggccgactacgtcaaggcg
ttctggaatgtcgtgaactgggaggatgtgcagaaccgctacgctgcggccacttccaag
accaacggcctgatcttcggctag

DBGET integrated database retrieval system