KEGG   Mycolicibacterium fortuitum: XA26_60700Help
Entry
XA26_60700        CDS       T04105                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mft  Mycolicibacterium fortuitum
Brite
KEGG Orthology (KO) [BR:mft00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XA26_60700 (ahpF)
Enzymes [BR:mft01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     XA26_60700 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like Glutaredoxin FAD_binding_3 Thi4 DAO K_oxygenase FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ALI29851
UniProt: A0A0N9YJ11
LinkDB All DBs
Position
6210985..6212598
Genome map
AA seq 537 aa AA seqDB search
MELIHMLDTSLAGQLKSLLERLTVPIELVSSLDDGPKSAELAELLTEIAAMSDKISYSRA
DDDARRPSFVIRRTGTDVEVRFAGIPLGHEFSSLALALLQVGGYPSKEAPELLEQVRNLG
AGGAGNPAGADLHFETYFSLSCQNCPDVVQALNLMAILNPRISHVAIDGALFKDEVEQRK
VLAVPTVFLNGELFDSGRMTLEQIIGKVDTGAAQRTAEAITEKDPFDVLVVGGGPAGAAA
AIYAARKGIRTGVVAERFGGQVLDTMAIENYISVPHTEGPKYAAALEAHVGEYDVDVMKT
QRGAKLLPAIDEGGLIEISLESGASLTARTVILATGARWRAMDVPGEAEYRNKGVTYCPH
CDGPLFKGKRVAVVGGGNSGVEAAIDLAGVVSHVTLIEFDSVLRADEVLQRKLRSLPNVD
ILLSTLTTEVLGDGDQVTGLTYQDRTTGQSHNLELQGVFVQIGLLPNTEWLEGSVELSKR
GEIVIDERGQTSVPGVFAAGDCTTVPFKQIVIAAGAGATAALSAFDHLIRTTAPVSG
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggagttgatccacatgctcgacacctcactcgccggccaattgaagtccctgctggag
cggctgaccgtgccgatcgagctggtgtcctccctcgatgacggtcccaagtccgccgaa
ctcgccgaactgctcaccgagatcgcggcgatgtcggacaagatcagctattcgcgcgcc
gacgacgatgcccggcggccgtccttcgtcattcgccgcaccggcaccgacgtcgaggtc
cggttcgccggcatcccgctgggccacgagttctcctcgctggcgctggcactgctgcag
gtcggcggctacccgtcgaaggaagcccctgagctgctcgagcaggtccgcaacctcggc
gccggcggggccggcaatccggccggcgcagacctgcatttcgagacctacttctcgctg
tcctgccagaactgccccgacgtggtgcaggcgctgaacctgatggcgatcctcaacccg
cgcatcagccacgtcgccattgacggcgcgctgttcaaggacgaggtcgaacagcgcaag
gtgctggcggttcccaccgtcttcctcaacggtgagttgttcgactccggccgtatgacg
ctggagcagatcatcgggaaggtcgacaccggcgccgcgcagcgcaccgccgaggcgatc
accgagaaggaccccttcgacgtgctggtggtcggcggcgggcccgcaggggcggcggcc
gcaatctacgctgcccgcaagggaattcgcaccggcgtggtcgccgagcggttcggcggt
caggtgctcgacaccatggcgatcgagaactacatctccgttccgcacaccgagggaccg
aagtacgccgcggcactggaagcccacgtcggcgagtacgacgtcgacgtgatgaagacc
cagcgcggcgcgaagctactgcccgcgatcgacgagggcgggctcatcgagatctcgctg
gagagcggtgcctcgctgaccgcgcggaccgtcatcctcgcgaccggtgcccgctggcgc
gcgatggatgtgccgggtgaggccgagtaccgcaacaagggtgtcacctactgcccgcac
tgcgacggaccgctgttcaagggcaagcgtgtcgccgtagtcggcggcggcaactccggc
gtggaggccgcgatcgacctggccggcgtcgtctcccacgtgacgctgatcgaattcgac
tcggtgctgcgcgccgacgaggtgctgcagcgcaagctccgcagcctgcccaacgtcgac
atcctgctgagcacgctgaccaccgaggtcctcggcgacggcgaccaggtgaccggactg
acctaccaggaccgcaccacgggccagtcacacaacctcgagctccaaggcgtcttcgtc
cagatcggactgctgcccaacaccgagtggctggaaggcagcgtcgaactgtccaaacgc
ggtgagatcgtcatcgacgagcgcggccagacgtcggtcccgggtgtgttcgccgccggt
gactgcaccacggtgccgttcaagcagatcgtcatcgccgccggagccggcgcgacggca
gcgctgtccgcgttcgatcacctgatccggaccaccgcccccgtcagcggctga

DBGET integrated database retrieval system