KEGG   Myxococcus fulvus: LILAB_03285Help
Entry
LILAB_03285       CDS       T01558                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mfu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LILAB_03285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mfu01002]
    LILAB_03285
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mfu01011]
    LILAB_03285
Enzymes [BR:mfu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LILAB_03285
   3.4.21  Serine endopeptidases
    3.4.21.-  
     LILAB_03285
Peptidases [BR:mfu01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   LILAB_03285
Peptidoglycan biosynthesis and degradation proteins [BR:mfu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   LILAB_03285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 PHP_C HEAT_2
Motif
Other DBs
NCBI-ProteinID: AEI62582
UniProt: F8CI25
LinkDB All DBs
Position
complement(781188..783437)
Genome map
AA seq 749 aa AA seqDB search
MQVHRASSILAASAILFLSLSHAAHAAPAVSAEKRADREALKSALLEVLQRAPLKASRMG
VHMQSLDDGAVVFSHNADELLNPASNVKLVTSAAALAALGPEFRYDTEFLVEPELGADGK
VKTLYVRGKGDPSMTTERLWGIVAELWNAGIREVGEIVVDDSWFDAERTPPGYDQEDTDR
AYMAPTGAVSLNWNAVAIYLRPGSAPGAKGLVAVEPPSDFFVVENQLTTGARRARRVFVK
SDAAGLRQKIVVRGQLPVERTGAVSVWKKIDNPPMYFGQSLKQMMVMRGVKMRGRVKLGK
TSTKARMLHVSQSDTFDVLLKRLNKLSSNFVAEQLLKTMGAEMRGAPGSFAKGVDVVEQF
LERDVGIPRGTYVMKNGSGLNDANRFSATQLNKLLRHMVQRFPFAPEYLSSVPIAGKDGT
LKYRFEGSDAVGRLRAKTGTLESVSALSGYVTSAGGERFTFSIMANDFAGRAGPIVAGLD
ALGAAVAATGSSLGPSTAVAALADSGRPAGAVDDVAARIKTYLDLGAQRDQRNIGFLRTA
WRSERDPAVRAVLAESLYQSNPHDYLGARTLLDSYAATAEVYGRLKDVARVLSVEVPGVS
SMVELAAGGNAEALARVLELAGAAGSDAQAQGEMAEALGEVARTAPEELVVALRAASAGD
RDACTTLLARALVQAGQADHPFWKSLRRTLGASDPRLATFAKGLDSTLSQKVAEARAPVK
TPEGFTPVEVVAPAGNAPESSTADNRPGG
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggtccatcgagccagctccatcttggccgcatcggccatccttttcctgtcgctt
tctcacgccgcgcacgccgcgcccgccgtctccgcggagaaacgcgcggaccgcgaggcg
ctgaagtccgcgctgttggaggtgctccagcgcgcgccgctgaaggccagccgcatgggc
gtgcacatgcagagcctggatgacggcgcggtggtgttcagccacaacgcggacgagctg
ctcaaccccgcctccaacgtgaagctggtgacgtccgccgccgcgctggcggccctgggg
ccggagttccgctacgacaccgagttcctggtggagccggagctgggcgcggacggcaag
gtgaagacgctctacgtgcgcggcaagggcgacccgtccatgacgacggagcgcctgtgg
ggcatcgtcgcggagctgtggaacgcgggcatccgcgaggtgggcgaaatcgtggtggac
gactcctggttcgacgccgagcgcacgccgcccggctatgaccaggaggacacggaccgc
gcctacatggcgcccaccggcgcggtgagcctcaactggaacgcggtggccatctacctg
cggcccggcagcgccccgggcgccaagggcctggtggcggtggagccgcccagcgacttc
ttcgtggtggagaaccagctcaccaccggagcgcgccgcgcgcgccgggtgttcgtgaag
tcggacgccgcgggactccggcagaagattgtcgtgcgcggccagctcccggtggagcgc
accggcgccgtcagcgtctggaagaagattgacaacccgcccatgtacttcggccagtcg
ctcaagcagatgatggtgatgcgcggcgtgaagatgcggggccgggtgaagctgggcaag
acgtccaccaaggcccgcatgctgcacgtgtcgcagtcggacacgttcgacgtgctcctc
aagcgcctcaacaagctgtccagcaacttcgtggccgagcagctcctgaagacgatgggc
gcggagatgcggggcgcgccgggctccttcgccaagggcgtggacgtggtggagcagttc
ctggagcgcgacgtgggcatcccccgcggcacctacgtgatgaagaacggcagcggcctc
aacgacgccaaccgcttctccgccacgcagctcaacaagctgctgcggcacatggtgcag
cgcttccccttcgcgccggagtacctgtcgtcggtgcccatcgccggcaaggacggcacg
ctgaagtaccgcttcgagggcagcgacgcggtgggccggctgcgcgccaagacgggcacg
ctggagagcgtgtccgcgctgagcggctacgtcacgagcgcgggtggagagcgcttcacc
ttctccatcatggccaacgacttcgcgggccgcgcgggccccatcgtcgcgggcctggac
gcgctgggcgcggcggtggccgccaccggctccagcctggggccctccacggcggtggcc
gcgctggcggacagtggccgtcccgcgggcgccgtggatgacgtggccgcccgcatcaag
acgtacctggacctgggcgcccagcgcgaccagcgcaacatcggcttcctgcgcaccgcc
tggcgcagcgagcgcgacccggccgtgcgcgcggtgctggcggagagcctctaccagtcc
aacccgcacgactacctgggcgcgcgcacgctgctggacagctacgcggccaccgctgaa
gtctatggccggctgaaggacgtggcgcgggtgctgtccgtggaggtgccgggcgtcagc
agcatggtggagctggcggcgggcgggaacgcggaggcgctcgcccgcgtcctggagctg
gccggcgctgcgggctcggacgcgcaggcgcagggcgagatggcggaggccctgggcgag
gtggctcgcaccgcgccggaggagctggtggtggcgctgcgggccgccagcgccggggac
cgggacgcgtgcaccacgttgctggcgcgcgcgctggtgcaggcgggccaggcggaccac
cccttctggaagtccctgcgccgcacgctgggcgcgtctgacccgcggctggcgaccttc
gccaagggcctggattccacgctgtcgcagaaggtggcggaggccagggccccggtgaag
acgccggagggcttcaccccggtggaggtggtggcgcccgcgggcaacgcgccagagtcc
tccaccgccgacaaccgcccgggcgggtag

DBGET integrated database retrieval system