KEGG   Myxococcus fulvus: LILAB_05020Help
Entry
LILAB_05020       CDS       T01558                                 

Definition
(GenBank) serine/threonine protein kinase Pkn9
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mfu  Myxococcus fulvus
Brite
KEGG Orthology (KO) [BR:mfu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mfu01001]
    LILAB_05020
Enzymes [BR:mfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LILAB_05020
Protein kinases [BR:mfu01001]
 Serine/threonine kinases: Other
  Bacterial family
   LILAB_05020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Pkinase_fungal RIO1 ABC1
Motif
Other DBs
NCBI-ProteinID: AEI62925
UniProt: F8CNK8
LinkDB All DBs
Position
1203287..1204954
Genome map
AA seq 555 aa AA seqDB search
MCPRDGTVVLSSFDVPPRAEEPNVVVQSVEPPAPAAMHKDPLIGLKLGEYELRSRIGVGG
MGLVYEGIQPLIGKRVAVKVLRPELAHSTEQVERLLAEARAVNAIRHRGIIDIFGFGQVP
DGRQYIVMEYLEGQALDAVLTEKSRLPVQEALALLDEVLAALAAAHGAGVVHRDLKPSNI
FLVQQPDGSRYVKVLDFGLAKRGQGPTGRTAQTRTDMVVGTPEYMAPEQARGQEVGPMTD
LYALGVVTFEIVTGRLPFVGSSPVDLLMKHVEARPPRPSEFVSDLPPALDAFILQMLTKD
PETRPNSADALRQQLHKLRRTLRASTRSNPSAPAPGFEKSAAAAAEADSRRPTTPVPVPP
ELSSELTSQELRAAGVRGSLRKHLPLVGAVGFAFVLLAGAAAVVIRGSNAPALVPPSVAP
APATPPPAPAPAEAERAPVEEVPLQPLVAAPLLPSATQTPRPEAARPRPSPGDTRVAPPR
PMRASAPSLEDILQSIDRLERRVDRLETSGKIDAPKANAARNLLAKYRDDARADTSAPAR
IDLLKKVTGVAGMIR
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcccgcgtgacgggacggtggtgctgtcgtcgttcgacgtgcctccgcgcgcggag
gagccgaacgtcgtggtgcagtccgtggagccgcccgcgcccgcggccatgcacaaggac
ccgctcattggcctgaagctgggcgagtacgagctgcgctcgcgcatcggcgtgggcggc
atggggctggtgtacgaaggcatccagccgctcatcggcaagcgcgtggcggtgaaggtg
ctgcggccggagctggcccactccaccgagcaggtggagcggctgctggcggaggcccgc
gccgtcaacgccatccgccaccggggcatcatcgacatcttcggcttcggccaggtgccg
gacggccggcagtacatcgtcatggagtacctggagggccaggcgctcgacgcggtgctg
acggagaagagccggctgccggtgcaggaggcgctggcgctgctggatgaggtgctggcc
gcgctggccgccgcgcacggcgcgggcgtggtgcaccgcgacctcaagcccagcaacatc
ttcctggtgcagcagccggacggctcgcgctacgtgaaggtgctggacttcgggctcgcc
aagcggggccagggccccaccggccgcacggcgcagacgcgcacggacatggtggtgggc
acgccggagtacatggcgccggagcaggcgcgcggccaggaagtggggcccatgacggac
ctctacgccctgggcgtcgtcaccttcgaaatcgtcaccggccggctgcccttcgtgggc
agctcaccggtggacctgctgatgaagcacgtggaggcgcggccgccccggccgtcggag
ttcgtctccgatttgccgcccgcgctggacgccttcatcctgcagatgctcaccaaggac
ccggagacgcgccccaactcggcggacgcgctgcggcagcagctccacaagctgcgccgc
accctgcgggcctccacgcgctccaaccccagcgcgcccgcgcccggcttcgagaaatcc
gccgccgccgccgcggaagccgactcgcgccgccccaccacgccggtgccggtgccgccg
gagctgagctcggagctgacgtcccaggagctgcgcgccgcgggcgtgcgcggctccctg
cgcaagcacctgccgctggtgggcgccgtgggcttcgccttcgtgttgctcgcgggcgcc
gccgccgtcgtcatccggggctcgaacgcacccgcgctcgtgccgccgtccgtcgcgccc
gcgccggccacgccgcctccagcgccggctcccgccgaggccgaacgggctccggtggag
gaggtgccgttgcagccgctggtcgccgcgcccctcctccccagcgccacgcagacgccg
cgtccggaggccgcgcggccccggccctcccccggggacacccgcgtggcgccgccccgg
cccatgagggcgtccgcgccctcgctggaggacatcctccagagcatcgaccggctggag
cggcgggtggaccggctggagacgagcgggaagattgacgcccccaaggccaacgccgcc
cgcaacctgctggcgaagtaccgcgacgacgcgcgggccgacaccagcgcccctgcccgc
atcgacctgctcaagaaggtgacgggcgtggcggggatgattcgctag

DBGET integrated database retrieval system