KEGG   Myxococcus fulvus: LILAB_06090Help
Entry
LILAB_06090       CDS       T01558                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mfu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LILAB_06090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mfu02000]
    LILAB_06090
Enzymes [BR:mfu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LILAB_06090
Transporters [BR:mfu02000]
 Other Transporters
  Pores ion channels [TC:1]
   LILAB_06090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C Tom37 GST_C_3 GST_C_6 GST_C_5
Motif
Other DBs
NCBI-ProteinID: AEI63139
UniProt: F8C7E1
LinkDB All DBs
Position
complement(1453319..1453897)
Genome map
AA seq 192 aa AA seqDB search
MTMKLYFNPRSRAAIARWMLDECGAPYEIVPIDFEKKENKSPEFLKINPAGKLPALVDGD
TRLFEGAAICLYLADKFPEAQLAPKLGDKDRGRYLSLMVYSTSQLEPAMSDHMMKLPTSP
SRGWTDFETALNVIEGELGQGPYLFGERFTAADVMIGSMFIWMRIFGSKTGRPALEAYVE
RLLARPKGMKLG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgaagctctatttcaacccgcgaagccgcgcggccattgccaggtggatgctg
gatgagtgtggcgcgccgtatgaaatcgtccccatcgacttcgaaaagaaggagaacaag
tcgcctgagttcttgaaaatcaaccccgctgggaaattgccagccctggtggatggcgac
acgcggctgttcgagggcgcggccatctgtctctacctggcggacaagttcccggaggcg
cagctcgcgccgaagctgggggacaaggaccggggccgctatctgtcgttgatggtgtac
tccacgtcccagctcgagcccgccatgagcgaccacatgatgaagctgcccacgagtccc
tcgcggggctggacggacttcgagacggcgctcaacgtcatcgagggtgagctgggccag
gggccctacctgttcggtgagcgcttcaccgccgcggacgtgatgattggctccatgttc
atctggatgcgcatcttcgggagcaagacggggcgcccggcgctggaggcctacgtggag
cggctgctggcccgccccaagggcatgaagctgggctga

DBGET integrated database retrieval system