KEGG   Myxococcus fulvus: LILAB_15630Help
Entry
LILAB_15630       CDS       T01558                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mfu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LILAB_15630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mfu02000]
    LILAB_15630
Enzymes [BR:mfu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LILAB_15630
Transporters [BR:mfu02000]
 Other Transporters
  Pores ion channels [TC:1]
   LILAB_15630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_C_2 GST_N_2 GST_N_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AEI65029
UniProt: F8CIG3
LinkDB All DBs
Position
complement(3703045..3703653)
Genome map
AA seq 202 aa AA seqDB search
MKLFYSPGACSLSPHIILREGGFAFTTEKVDIRAKKTAAGEDFLGINAKGYVPALQLDDG
SLLTEGPAIVQYLADQVPDKKLAPANGTLARYRLQEMLNFISTEIHKGFSPLFNPAFPEE
GKRLTKERLALRLGVLEAVVAKQAFLMGEQFTVADAYLFTTLNWAGHTKVDLEPFPALRA
YHARVADRPSVQEALKAEGLAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcttctactctcctggtgcctgttcgctgtcgccccacatcatccttcgcgag
ggcggcttcgccttcaccaccgagaaggtggacatccgcgccaagaagacggcggcgggc
gaggacttcctcggcatcaacgccaagggctatgtcccggcgctgcagctcgatgacggc
agcctgctgacggagggccccgccatcgtccagtacctggccgaccaggtccccgacaag
aagctggccccggccaacggcacgctggcgcgctaccgcctccaggagatgctcaacttc
atctccaccgaaatccacaagggcttcagcccgctcttcaacccggccttcccggaggaa
ggcaagcggctgacgaaggagcggctcgcgctgcgactgggcgtgctggaggcggtggtg
gcgaagcaggcgttcctgatgggtgagcagttcaccgtggcggacgcgtacctcttcacc
acgctcaactgggccggccacacgaaggtggacctggagccgttccccgcgctgcgcgcc
tatcacgcccgcgtggcggaccggccctccgtgcaggaggcgctgaaggccgaaggcctc
gcgaagtga

DBGET integrated database retrieval system