KEGG   Myxococcus fulvus: LILAB_26215Help
Entry
LILAB_26215       CDS       T01558                                 

Definition
(GenBank) non-ribosomal peptide synthase
Organism
mfu  Myxococcus fulvus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C Bac_luciferase
Motif
Other DBs
NCBI-ProteinID: AEI67135
UniProt: F8CAT3
LinkDB All DBs
Position
6235998..6251213
Genome map
AA seq 5071 aa AA seqDB search
MHSPLAVTLLELLETRTRSHGAQPLYTFLEDGGDDAVLSYAGLDVRARRIGAALQALSRA
GERAVLLYPPGLEYIAGFFGCLYAGLIAVPAYPPDPMRLDRTLPRLRAIIRDARASVVLT
TSFIQEMGEGLFEGAPELAALRWVATDALAEGMEDGWRRPAPTGDTLAFLQYTSGSTGDP
KGVRLSHGNLLHNLGLISHAFQVRSDSVGVIWLPPYHDMGLIGGILQPLYAGFPVALMSP
LAFLRRPRFWLEALSRFGGSISGGPCFAFDLCVRKVPAAEREGLDLRRWELAFCGAEPIR
PEVMARFSEAFAPVGFQREALYPCYGLAEGTLIASGGRKGEGILTRTWDAQALERNEALA
VEGGPNARPLVGSGQTLPDQALLVVDPQTRLPCPPERVGEIWVSGPSVAQGYWERPEESE
AAFGARLADADSGPRFLRTGDLGLMKDGELFVVGRRKDLIILRGRNLHPQDLELTLERSH
PALRPGCGAAFAIDVGGEERLAVVYEVDSRKPWTPEDVVSAVRRGLSETHEVQLHTLVLI
EPGALPKTSSGKIQRRACRAELLAGTLRAQLTWSEADAEAPRAEPGAPAVVASEPRTVEE
LEAWLVARIAARLRVRPEDLTKDAAITSFGLDSLGAVELANDIESLGVVLRMEVLLQGPT
VAELARTVFAARGKPSGAELTRGEETAPAPLSSAQQRLWLFAQLAPGSAAYHLPAAVRLT
GALDVAALERAFAAILQRHEALRATFREEDGTPWQVSAPAAVSALRTVDLRDVSPELREA
TALRLAQEAARAPFELAHGPLLRATLLQLAPQEHLLVVVMHHLASDGASFAILARELSAL
YAGDASLPPLALQYPDFARWRREVEAEGAMATAIYWWKAHLAGLPAALELPADRPRPPMP
SYCGGRVAVRLPEALTVRLEALGRSEGATLFMTLLAALEVLLARHSGQADFCVGTAVNGR
ERSGLEGLIGCFLDLVVLRASVDGASRFRELLGATREGVLAAFAHRGVPFERLVEAIQPT
RDPSRAPLFQVLFVLQPEPGAGLALPGLEARRVEVDPGATPYDLTLSLARSAEGLGGWLE
YASDLFDADTAARLVARLEVLLEAVVADPEQRVGALPLLPEAERRQVLTGWNATRTDFPE
TCVHALIEAQARRTPDTVAVVCGDEALTYRELDQRANAVAWRLREQGVGPERVVGLFADR
SVDLAVGLLGILKAGGAYLPLDPSYPEARLALMLEDSGAAVVLAHRHLAGALPAGRRTVV
TLDVRALADGPPPIAVAPGNLAYVLYTSGSTGRPKGVLIPHRNVANFFMGMDARVGAAPG
TWLAVTSVSFDISVLELLWTLARGFKVVVQGEQGALGAAPRRGSRTRRAPLGFSLFYFAA
DEGAPGAERYRLLLEGARFADRHGFQAVWTPERHLHAFGGLYPNPSVTSAAIAAITERVA
IRAGSVVLPLHHPVRVAEEWALVDNLSKGRVGISVAPGWHANDFVLAPERYEDRRELARG
ALDTVRRLWRGEALRFANGAGASTEVRLRPSPVQRELPVWLTAAGNPDTFREAGRLGAGV
LTHLLGQRWEELEARIALYREAWREAGHEGEGHVTLMLHTFVGQDVERVRETVEGPLRRY
LSDSADLMRGLGRTLGVDLDPASVRPEDLDALVGRAFGRFFEGAGLFGTPRTCRDQVARI
EALGVDEVACLIDFGVDTDEVLASLPALDAVRQRCERDFRLQSQGDDAVPAQLRRHGVTH
LQCTPSLAQALLLEPGAPGALAGLERLLVGGEALSEALAARLRGTVGGALLNMYGPTETT
IWSASHAVREAAGPVPIGTPIANTSLYVLDAALRPVPVGVPGELYIGGAGVARGYHARPE
LTAERFLPDPVASEAGARMYRTGDRARWRADGAVEFLGRVDHQLKVRGFRVEPGEIEAVL
ARHPAVARAVVVAREDLPGSARLVAYLVPRLEASLSGDALLAYARRALPEHMVPSAWVTL
EALPLTPNGKVDRKALPAPEGVRDVGREYVAPRTETERRLAELWASLLGVPRVGAEDDFF
ALGGQSLLATRAASRIREAFGVDLPLRELFESASPAALGARLDARRLRASGGPALLARSH
EGALPLSFAQQRLWFLEQLEPGGAAYNDAVAVRVEGALDVPLLERCLREVVRRHDVLRAT
FHEEDGAASWRVHAEPRLALTRVDLTAGEAAARAEALARRLEAESLRAFDLGAGPPLRVM
LAQVGAREHVLLLVLHHLVTDGASMGVLVREVAALYRAFARGEPSPLPALPLQYVDYAAW
QRDWLRGEALEAQLAYWRARLEGAPRALELPTDRPRPAVRGSRGVSREVCLGAELTRGLK
SLARREGATPFMVLLAGFSALLSRHAGQDDLCVGTPVAGRDRTELEGLIGCFVNTLVLRV
SLAGAPSFLELIGRARETVLGAFAHQDAPFEELVKALQPERDLGRSPLFQAMLVMQEDPL
PELTVPGLRLSVQPQPSHTAKFDLRLILTDTPEGFSANLELSADLFEPDTASRLLEHLRV
LLEAGVRSPEQRVSDLPLMSPAERHQVLVAWNDTLRPRPEAAVLHRLIEAQVDRTPDAVA
VSFEGDALTYRELDLRANQLARFLRARGVGPDTRVAQCTERSLEMVVGLLGVLKAGGAYV
PLEPEYPRERLAFMLADAAAPVLLTQARLAAGLPHGGAAVVCLDSEWGVISREPDTRLDV
AVEGSGLAYVIYTSGSTGRPKGVMNTHAAICNRLLWMQEAYGLDASDRVLQKTPFSFDVS
VWEFFWPLLTGARLVMARPGGHREPAYLTETIARERISTLHFVPSMLRPFLEEPGLEASC
ASLRRVFCSGEALPAELRDRCFSRLGAALHNLYGPTEAAVDVTAWTCEREDRRPVVPIGR
PIANTRLYVLDALLRPVPVGVPGELYIGGVALARGYWRRAALTAERFLPDAFAATPGARM
YRTGDQARFLADGAIEYLGRLDDQVKVRGFRIEPGEIEAALARHPDVRAAAVVVREDVPG
DRRLVAYVAGAPADGGAALRAFLGERLPEHMVPSAFVSMEALPLSPSGKLDRRALPAPPR
AVPGEGAGFVAPRNEQERQLARIWAGVLGVERVGVEDRFFELGGDSILALQVIARARQVG
LHLTARQLFQHPTVAALAQVAGGVRRAGEQGPVVGPVPLTPIQRWFVERELPEPHHFNQA
LMLEPREPLAPEVLARALAALVDHHDALRLRLSRADTGWAQSCDEPGREVPLRRVDLTGL
EVPEQAEAMARVAAEVQAGLDLASGCLLSAVLFERGRARSGRLLLVIHHLAVDGVSWRVL
LEDLETALRQLARGEPVALPAKTTSFQEWARRLEVHAASASVAGERAFWRETTSAEVSPL
PRDFADGVNTQGSERVVTVALEAEVTRSLLRSAGVAPEEVLLAGVACTLSRWTGQRRLRI
DLEAHGREELFEDVDLSRTVGWFTSLFPVRLELSEEPASALASVRASREHRKGRGLGYGL
LRYLRREDDVPAAFGAGASSEVLFNYLGQLDSGARESALFALAAEPTGPSQGTRGLRSHA
LEVVARVVGGRLELAWHYSEALHARERIEALARECLEVLAELAGATEQRSPLSPLQHGLL
FQVLLEPGTEAYFEQRSWALSGPLDPEALRRAWEAVSERHASLRTSFQWEGLESPVQVVH
ARSAPVWRELDWRGLAPEARAQALDAFLREDRAQGFVLSRAPLMRLTLMRLEDRVWRLVW
SFHHLLLDGWSLARVLGEVLDAYAALSRGEAWRPPAAMDFRAYVEWLAHREPEQDEAFWR
AQLAGIEAPTPLPLDGAGGHGTGEHAVALGEADTAALQDFARRHGLTPSTLVHGAWALLL
SRHGGTADVVFGTTLAGRPPELPGIEEAVGLFIHSLPLRARIQRGAGVVAWLRELQSTLV
ELGQRGHVPLTRLQGWSDVPRGTPLFESLLVFENYPVDAALARGAAGLELGDFMAFERTH
YPLTAVAVPGPSLRLKLLYRQERVAPDAAARLLSHWSGLLREMLRRPEQRLGEVSLLSEV
ERRRVLVEWNATATAYPRGATVHALFESQATRTPDAVAVRYGETSLTYAELDARANRVAH
RLRGMGVQRGAHVGLCAERSVDLVVGLLGVLKAGGAYVPLDPTYPRERLAWMLADARAQV
LLTQERLRAALPSAGLRVLTFEEVAAEPDTVGAPPPSGAGAEDLAYVIYTSGSTGTPKGV
CVPHQAVVRLVVETNFIHVVPEDRVAQASNASFDAATFEIWGALLNGARVVGVNRETALS
PRAFASWLREEGIRVLFLTTAWFNQVAAEVPDAFGGVRQLHFGGEAVDPRPVRQVLRAGP
PGRLLHVYGPTENTTFSTWHHVTDVPEGATSIPIGRPLANTVQYVLGVDLAPVPPGGVGE
LWLGGDGLAWGYLGQPALTAERFVPDPFSTRPGARLYRTGDRVRLLADGAVTFEGRVDAQ
VKVRGFRVEPGEVEAALLRHPDVRQAVVLAREDDAGGSRRLVAYVVTAAERSATPAVLRA
FLAAHLPAYMVPAVIMPLERLPLTPNGKVDRKALPAPRVESDVPTSLGPEEARVASLFGE
LLGVARVGAADSFFDLGGHSLLATRVVTRLQASFGVVLTLRELFDSPTVAGLAERIRQVR
RSSGPERPPPIIPVSRDAPLPLSAMQERLWLLEQLQPGTALYNVPWAAWLTGPLDVPALE
RALAGLFLRHEALRTTFASNAGEPVQVIHPSAGVALPVVDLGALPEAEREAQALHVASEE
ARRPFDLSNGPLCRALLIRTASEAHLLVLTLHHIISDGWSLGVAVRELSALYGAELRGRP
AALPAPTLQPADHAVWQREWLQGEALSAQLGYWREQLAGAPPVLELPKDFPRPGLQRFRG
DTLSVQLPAGLSESFRALCGREGVTPFMGLLAAFQLLLSRVSGQEDVCVGAPIAGRQQPG
LEDLIGFFVNTLVLRARLPRSLSFRELLRQVRETTLEAYAHQDVPFEKLVEALQPPRSLS
HAPLVQVVLALHEPARPDAAPEGLTLRPVELASGTSKFDLTLSLVDAPEGFTGTLEYDAD
LFTRETAARLMQALRVLLESAVADAGQRRCR
NT seq 15216 nt NT seq  +upstreamnt  +downstreamnt
atgcactctccactggccgtgacactcctggagttgcttgaaacgcggacccggtcgcac
ggagcgcagccgctctacaccttcctggaggatggcggcgacgacgcggtgctgagctac
gccgggttggacgtgagggcccggcgcatcggcgcggcactccaggcgctgtcacgagcg
ggcgagcgggccgtcctcctgtatccaccgggcctggaatacatcgccgggttcttcggg
tgcctgtacgccgggctgatcgccgtcccggcctatccgccggacccgatgcggttggac
cggaccttgccccgcttgcgcgccatcatccgtgatgcgcgcgcgagcgtcgtgctcacc
acgtccttcatccaggagatgggagaggggctcttcgaaggcgcgccggaactcgccgcg
ctgcgctgggtggccacggacgcgctcgcggaggggatggaggacggctggcggcgtccg
gcgcccaccggggacacgctggccttcctccagtacacgtccggctccacgggggacccc
aagggggtgcggctcagccacggcaacctgctgcacaacctggggttgatctcccacgcg
ttccaggtccgctcggacagcgtgggcgtcatctggctgccgccgtaccacgacatgggg
ctgattggtggcatcctccagccgctctacgcgggcttccccgtggcgctgatgtcgccg
ctcgcgttcctccgccggccgcggttctggctggaggccctgtcccgcttcggcggcagc
atcagcggggggccctgcttcgcgttcgacctgtgcgtgcggaaggtgccagccgcggag
cgcgaggggttggacctgcgccgctgggagctggcgttctgcggcgcggagcccatccgt
ccggaggtgatggcgcgcttctcggaggcgttcgcgccggtgggcttccagcgggaggcc
ctgtacccctgctacgggttggcggagggcacgctgatcgcatcgggtgggcgcaagggg
gaggggattctcacgcgcacctgggatgcccaggcgctggagcggaacgaggcgctggcg
gtggagggcggccccaatgcgcgtccgctggtcgggtccggccagacgctgcctgaccag
gccttgctcgtggtggatccacagacgcgccttccgtgcccgcctgagcgggtgggggag
atctgggtgtccgggcccagcgtggcgcagggctactgggagcggcccgaggagagcgag
gcggccttcggcgcgcggctggcggacgcggacagcgggccgcggttcctgcggaccggg
gacctgggcctcatgaaggacggcgaactcttcgtcgtgggccggcgaaaggacctcatc
atcctgcgtgggcgcaacctgcacccgcaggacctggagctgacgctggagcgcagccac
ccggcgctgcggcccgggtgtggcgcggcgttcgccatcgacgtgggcggggaggagcgg
ctcgcggtggtgtacgaggtggactcgcgcaagccgtggacgcccgaggacgtggtgagc
gcggtccgccggggcctgtcggagacgcacgaggtccagctccacacgctggtgctcatc
gagccgggggcgctgccgaagacgtccagcgggaagattcagcggcgcgcctgccgggcg
gagctgctcgcggggacgctccgggcgcagctgacgtggagcgaagcggacgcggaggcg
ccgcgggccgaaccgggagcccccgcggtggtcgcgtccgagccgcggaccgtggaggag
ctggaggcgtggctggtggcgcggatcgccgcgcggctccgcgtgcgtcccgaggacctg
acgaaggacgcggccatcacgtccttcgggctggattcgctcggggcggtcgagctggcc
aatgacatcgagtccctgggcgtcgtcctccgcatggaggtcctgctccaaggacccacg
gtggcggagctcgcgcggaccgtcttcgctgcgcgagggaagccgtcgggcgccgagctg
acgcggggcgaagagacggcgcccgcgcccctgtcgtccgcgcagcagcggctgtggctc
ttcgcgcagctcgcgccaggcagcgccgcgtaccacctgccagcggcggtgcggctcacc
ggcgcgctggacgtggcggcgctggagcgcgccttcgcggccatcctccagcggcacgag
gcgctccgggccacgttccgcgaggaggatgggacgccctggcaggtgagcgcgcccgcc
gcggtgtccgcgctgcggacggtggacctccgcgatgtctcccccgagctgcgggaggcg
accgcgctccggctggcacaggaggcggccagggcgcctttcgagctcgcccacggacct
ctgctccgggccacgctgcttcagctcgcgccccaggagcacctgctcgtcgtggtgatg
caccacctcgcctcggatggagcgtcgttcgccatcctggcgcgggagctgagcgcgctg
tacgcgggagacgcttcgctgccgccgctggccctccagtacccggacttcgcgcgctgg
cgccgtgaggtcgaggcggaaggggcgatggccaccgccatctactggtggaaggcgcac
ctggcgggccttcccgccgcgctggagctgcccgcggaccggccgcgtccccccatgccg
tcctactgcggggggcgcgtggccgttcgccttccggaggcgctcacggtccggctggag
gcgctgggccggagtgaaggcgccacgctgttcatgacgctgctggcggccctcgaggtg
ctgctcgcgcgccactccggacaggcggacttctgcgtggggaccgccgtcaacgggcgc
gagcgaagcggcctcgaagggttgatcgggtgcttcctggacctcgtcgtgctgcgcgcg
tccgtcgatggggcatcgcgcttccgggagctgctgggggcgacgcgggagggcgtgctg
gcggcgttcgcccaccgaggcgtccccttcgagcggctggtcgaggccatccagcccacg
agggatccgtcgcgggcgccgctgttccaggtgctcttcgtgctccagccggagcccggc
gccggcctcgcgttgcctgggctggaggcgcgccgcgtggaggtggaccccggcgccacg
ccgtatgacttgacgctgtcgctggcccggagcgccgaggggctgggcggctggctggag
tacgcctcggacctgttcgacgcggacaccgccgcgcggctggtggcgaggctggaggtg
ctcctggaggccgtcgtcgcggacccggagcagcgcgtcggcgcgctgccgctcctcccc
gaggcggagcggcggcaggtgctgaccggatggaacgccacgcggacggacttcccggag
acgtgcgtccacgcgctcatcgaggcccaggcccggcgcacgccggacaccgtggccgtg
gtgtgtggtgacgaagccctgacgtaccgcgagctggaccagcgggccaacgccgtggcg
tggcggctgcgcgagcagggcgtgggcccggagcgcgtcgtggggctcttcgcggaccgc
tccgtggacctggcggtggggctgctgggcatcctcaaggcgggcggtgcctacctgccg
ctggacccgtcctatcccgaggcccgcctcgcgttgatgctggaggactccggcgccgcg
gtggtgctggcgcaccggcacctggcgggagcccttcctgctgggcgtcggacggtggtg
acgctggacgtgcgggcgctggcggacgggccgcctcccatcgccgtggcgccgggcaac
ctcgcctacgtcctctacacctcgggctccacgggcaggcccaagggcgtgctgattccc
caccgcaacgtcgccaacttcttcatggggatggacgcgcgcgtgggggcggcgccgggg
acgtggctggcggtgacgagcgtctccttcgacatctccgtgctggagttgttgtggacg
ctggcccgaggcttcaaggtcgtcgtgcagggcgagcagggggccctgggcgccgcgcct
cgccgcgggagccggacgcgccgcgcgccgctggggttcagcctcttctacttcgcggcg
gatgaaggcgcgccgggcgcggagcgctaccgcctgttgctggagggcgcgcgcttcgcg
gaccgccacggcttccaggccgtgtggacgccggagcgccacctgcacgccttcggtggg
ctctatcccaacccgtcggtgaccagcgcggccatcgccgccatcaccgagcgcgtggcc
atccgcgcgggcagcgtcgtcctgccgctgcatcaccccgtgcgcgtggccgaggagtgg
gcgctcgtcgacaacctgtcgaagggacgggtgggcatctccgtggcgccgggctggcac
gcgaacgacttcgtgctcgcgccggagcggtacgaggaccgccgcgagctggcgcgcggt
gcgctggacaccgtgcggcggctgtggcgcggtgaggcgctccgcttcgccaatggcgcg
ggtgcgtccaccgaggtccgcctccggccgagccccgtgcagcgcgagctgcccgtgtgg
ctcaccgccgccggcaatcccgacaccttccgcgaggcggggaggctgggggcaggtgtc
ctcacgcacctgttgggacagcgatgggaggagctggaggcgcgtatcgcgctctaccgc
gaggcgtggcgtgaggcggggcacgagggcgagggccacgtgacgctgatgctccacacc
ttcgtggggcaggacgtggagcgggtgcgcgagacggtcgaagggccgctgcggcgatac
ctgagcgactccgcggacctgatgcgcggcctggggcggacgctgggcgtggacctggac
ccggcgtcggtccgcccggaggacctggacgcgctggtggggcgcgccttcgggcgcttc
ttcgaaggcgccgggctcttcgggacgccgcgcacctgccgcgaccaggtggcgcgcatc
gaggcgctgggggtggatgaggtcgcgtgcctcatcgacttcggcgtggacacggatgag
gtgctcgccagcctgccggcgctggacgccgtgcggcagcgctgtgagcgggacttccgc
ctccagtcgcagggcgacgacgcggtgcccgcgcagcttcgccggcacggagtcacccac
ctgcaatgcacgccttccctggcgcaggcgttgcttctggagcccggggcgccgggggcg
ctcgcgggcctggagcggctgctggtcggtggcgaagcgctgtccgaggcgctggcggcc
cggctgcgcggcaccgtgggcggcgcgctcctcaacatgtacggccccacggagaccacc
atctggtccgcgtcacacgccgtgcgggaggccgcggggccggtgcccatcgggacgccg
atcgccaacacgtcgctgtacgtgctggacgccgcgctgcgcccggtgcccgtgggcgtg
cccggtgagctctacatcggcggcgccggcgtcgcccggggctaccacgcccggccggag
ctgacggcggagcgcttcctgccggaccccgtggcgtcggaggcgggcgctcgcatgtat
cggacgggcgaccgggcgcgctggcgggccgacggggcggtggagttcctgggccgggtg
gaccaccagctcaaggtccgcggcttccgggtggagccgggtgaaatcgaagccgtgctg
gcccgtcaccccgccgtggcgcgggccgtggtggtggcgcgagaggacctgcccgggagc
gcccggctggtggcgtacctggtgcctcggttggaggcgtcactctccggggacgcgctg
ctggcctacgcccggcgcgccctgcccgagcacatggtgccctcggcgtgggtgacgctg
gaggccctcccgctgacgcccaacgggaaggtggaccggaaggcgctgcccgcaccggag
ggcgtccgggacgtgggccgggagtacgtggcgcctcggacggagaccgagcgcaggctg
gcggagctgtgggcctcgctcctgggtgtgccgcgggtgggggccgaggacgacttcttc
gccctgggcggccaatcgctgctggccacgcgcgccgcgtcgcggattcgcgaggccttc
ggggtcgacctgcccctgcgcgagctcttcgagtcggcttcgccggcggcgctgggggct
cgtctcgacgcgcgccgtctgcgtgcgtcggggggccccgcgctgctggcccgctcgcac
gaaggcgcgttgcccctgtccttcgcgcagcaacgcctgtggttcctggagcagctcgag
ccgggtggcgccgcgtacaacgacgcggtggcggtccgggtggagggggcgctcgacgtg
cccttgctggagcgctgcctgcgggaggtggtccgccggcatgacgtgctccgcgccacc
ttccatgaggaggacggggcggcgtcctggcgcgtccacgccgagccccggctcgccctc
acgcgggtggacctgacggcgggggaggccgccgcgcgggcggaggcgctggcccggcgg
ttggaggcggagtcattgcgggccttcgacctcggggcggggccgccgctccgggtcatg
ctggcccaggtgggcgcgcgtgaacacgtgctcctgctcgtgctgcatcacctggtgacg
gacggcgcctccatgggcgtgctggtgcgcgaggtggccgcgctctaccgcgccttcgcc
aggggcgagccctcgccgctgcccgcgctgccgctccagtatgtggactacgcggcgtgg
cagcgcgactggctgcgtggcgaggcgctggaggcgcagctcgcgtactggcgggcgcgg
ctggagggcgcgcctcgggccttggagttgcccacggaccgtccccgccccgccgtgcgc
ggcagtcggggcgtgagccgcgaggtgtgcctgggggcggagctgacacgcgggttgaag
tcgctggcccggcgcgagggcgccacccccttcatggtgctgctggcgggcttctccgcg
ctgctgtcccgtcacgccgggcaggacgacctgtgcgtggggacgcccgtggcgggccgg
gaccggaccgagctggaggggctcatcggctgcttcgtcaacacgctggtgctccgcgtg
tcgttggcgggcgcgccttccttcctcgagctgattggccgcgcgcgggagacggtgctg
ggtgccttcgcgcaccaggacgcgcccttcgaggagctggtgaaggcgctccagcccgag
cgtgacctgggccgcagcccgctcttccaggccatgctcgtgatgcaggaggatccgctg
ccggagctgacggtccccgggctgcggctgagcgtccagccgcagccgagccacacggcg
aagttcgacctgcggctcatcctcacggacacgcccgagggcttctccgcgaacctggag
ctgagcgccgacctgttcgagcccgacaccgcgtcccgcctgctggagcacctgcgcgtg
ctgctggaggcgggcgtccgctcgccggagcagcgggtctcagacctgccgctgatgtct
ccggcggagcgccaccaggtcctggtggcgtggaacgacacgctccggccgcgaccggag
gcggccgtcctgcatcgcctcatcgaagcgcaggtggaccgcacgccggatgccgtggcg
gtgagcttcgagggagacgcgctcacgtaccgggagctggacctgcgcgccaatcagctc
gcgcgcttcctgcgggcccgaggcgtggggccggacacgcgagtcgcccagtgcacggag
cgctcgttggagatggtggtggggttgctgggggtgctcaaggcggggggcgcctatgtg
ccgttggagccggagtacccgcgcgagcgcttggcgttcatgctcgcggacgcggcggcg
cccgtgttgctcacgcaggcgcggctggccgcgggcctgccacacggtggcgcggcggtg
gtgtgcctggactcggagtggggcgtgatttcgcgcgagcccgacacgcggctcgacgtg
gcggtggaggggagcgggctggcgtacgtcatctacacctccggctccacggggcggccc
aagggcgtgatgaacacgcacgccgccatctgcaaccggctcctctggatgcaggaggcc
tacgggctcgacgcgagcgaccgggtcctccagaagacgcccttcagcttcgacgtctcc
gtctgggagttcttctggccgctgctgacgggggcccgcctggtgatggcgcgacccgga
gggcaccgggagcccgcgtacctgacggagaccatcgctcgcgagcgcatcagcacgctg
cacttcgtgccctccatgctccggcccttcctggaggagcccggcctggaggcgtcctgc
gccagcctgcggcgggtgttctgtagcggtgaggccctgcccgcggagctgcgggaccgc
tgcttctcgcgcctgggcgcggcgctgcacaacctctacggcccgaccgaggccgcggtg
gacgtgacggcgtggacctgcgagcgcgaggaccggcgccccgtcgtgcccattggccgc
cccatcgcgaacacgcggctgtacgtgctggacgctctgctgcgccccgtcccggtgggg
gtgccgggagagctgtacatcggtggcgtggccctggcgcgcggctactggcgccgggcg
gcgctgaccgcggagcgcttcctgccggacgccttcgcggccacaccgggggcgcggatg
tatcgcacgggcgaccaggcccgcttcctggcggacggcgccatcgagtacctggggcgc
ctggacgaccaggtgaaggtgcggggcttccgcatcgagccgggcgagattgaagcggcg
ctggcccggcaccccgacgtgcgggcggcggcggtggtggtccgggaggacgtcccggga
gaccggcgcctcgtggcgtatgtggccggggctccagcggacggcggcgcggcgctgcgc
gcgttcctgggggagcgcctgcccgagcacatggtgccgtcggcgttcgtctcgatggag
gccctcccgctgtcgcccagtgggaagctcgaccggcgcgcgctccccgcaccaccgcgg
gccgtgcccggggagggcgcgggcttcgtggcgccacgcaacgagcaggagcggcagctc
gcgcgcatctgggcgggggtgctgggcgtcgagcgggtgggcgtcgaggaccgcttcttc
gagctgggcggcgactccatcctcgcgcttcaggtgattgcgcgggcgcggcaggtgggc
ctccacctcacggcgcgtcagctcttccagcatccgacggtggcggccctggcccaggtg
gcgggcggcgtccgccgggcgggtgaacaaggcccggtggtggggcccgttcccctgacg
cccatccagcggtggttcgtcgagcgcgagctgcccgagccgcaccacttcaaccaggcg
ctgatgctggagccgcgtgagcccctggcgccagaggtgctggctcgcgcgctggcggcg
ctggtagaccaccatgacgcgctccggttgcggctgtcacgggcggataccgggtgggcg
cagtcgtgcgacgagcctgggcgtgaggtgccgctgcggcgggtggacctgaccgggctg
gaggtgccggagcaggccgaggcgatggcgcgagtcgccgctgaggtgcaagccgggctg
gacctggcgtccggctgtctcttgagcgcggtgctgttcgaacgggggagggcgcggtcg
ggccggttgttgctggtcatccaccacctggcggtggacggcgtctcctggcgtgtgctg
ctggaggacctggagaccgcgctccggcagcttgcccgtggcgagcccgtggcgctcccc
gcgaagacgacgtccttccaggagtgggcgcggcggctggaggtccatgcggcctctgcg
tcagtcgcgggggagcgggccttctggcgcgaaacaacgagcgcggaggtgtctccgctg
cctcgtgacttcgcggacggggtgaacacgcaggggtcggagcgcgtcgtcaccgtggcg
ttggaggccgaggtgacgcgctcgctgctgcgttcggcgggcgtcgcgccggaggaggtg
ctcctcgcgggcgtggcgtgcacgctgtccaggtggaccgggcagcgccggttgcgcatc
gacctggaggcccacggtcgcgaggagctgttcgaggacgtggacctgtcccgcacggtg
ggctggttcacctcgctgttccccgtgcggctggagctgtccgaggagcccgcctccgcg
ctggcctcggtccgggcctcgcgtgagcaccgcaagggcagggggctcgggtatggcctg
ctccgctacctgcgtcgcgaggatgacgtcccggcggcgttcggggcgggcgcctcatcc
gaggtgctcttcaactacctggggcagctcgactcgggcgcgcgggagtccgcgctgttc
gccctggccgccgagcccacggggccctcgcaggggacgcgcgggcttcgaagtcacgcg
ctggaggtcgtggcgcgcgtcgttggcggacggctggagctggcgtggcactacagcgag
gcgctgcatgctcgcgagcgcatcgaggccctggctcgggagtgcctggaggtgctggcg
gagctcgcgggcgcgacggagcagcggtctccgctctcgcctctccagcatggcttgttg
ttccaggtgctgctggagcccgggacggaggcgtacttcgagcagcgaagctgggcgctc
tccggacccttggaccccgaagcgctgcggcgcgcgtgggaggctgtgtccgaacggcat
gcctcgctgcggacctccttccaatgggagggcctggaatctcctgtccaggtcgtccac
gcgcggagcgctcccgtctggcgtgagctggattggcgtgggctcgcccccgaggcccgg
gcccaggcgctggacgcgttccttcgtgaggaccgggcccagggcttcgtgttgtcgcgc
gcgccgttgatgcggctgacgctgatgcggctggaggaccgcgtctggcgcctcgtctgg
agcttccaccatctgctgctggatgggtggagcctggcgcgtgtgctcggtgaggtgctg
gacgcctacgcggcgctctcgcgtggcgaggcctggcgcccgcccgccgcgatggacttc
cgcgcctacgtcgagtggctggcgcaccgcgagcccgagcaggacgaagccttctggcgg
gcgcagctcgcgggcatcgaggctccgacgccgttgcccctggacggcgctggcggacat
ggcacgggtgagcacgccgtggcgctgggggaggccgacacggcggcgctccaggacttc
gcgcgccgtcacgggctgacgccgagcaccctggtccatggggcgtgggcgctgctgttg
tcccgccatggtggcacggcggacgtcgtgttcgggacgacgctggcgggccgtccgccg
gagctgccgggtatcgaggaggcggtggggctgttcatccactcgctcccgctgcgagcc
cgcatccagcgcggcgccggggtggtggcctggctgcgcgagctccagtccacgttggtc
gaattgggccagcgcgggcacgttccgctcacgcggctccaggggtggagcgacgtgccc
cgaggcacgccgctcttcgagagcctcctggtcttcgagaactacccggtggacgcggcg
ctcgcgcgtggcgcggcggggttggagctcggggacttcatggccttcgagcggacccac
tatccgctgaccgccgtggcggtcccagggccgtcgttgcgcctgaagctgctctaccgg
caggagcgcgtcgcgcctgacgccgccgcgaggctgctgtcgcactggagcggcctgctc
cgggagatgctccgtcggccggagcagcggctgggcgaggtgtccctgctgtcggaggtg
gagcgtcgccgggtgttggtggagtggaatgccacggccaccgcgtacccgcgtggcgcc
acggtgcacgccttgttcgagtcccaggccacgcggacgcctgatgcggtcgcggtgcgc
tatggcgagacgtcgctgacctacgccgagcttgacgcgcgggcgaaccgggtggcccat
cggctgcgcgggatgggcgtccagcgaggggcgcatgtggggctctgcgcggagcgctcg
gtcgacctcgtcgtggggttgctgggtgtcctcaaggcgggtggggcctacgtgccgttg
gatccgacgtacccccgcgagcggctcgcgtggatgctcgcggatgccagggcccaggtg
ctgctgacccaggagcggctgcgggcggcgctgccctcggcggggttgcgcgtgctcacg
ttcgaagaggtcgcggcggagccggacactgtcggtgcgccgccgccttcaggggctggc
gccgaggacctggcgtacgtcatctacacctccggctccaccgggacgcccaagggtgtc
tgcgtcccgcatcaagccgtggtccggctggtggtggagacgaacttcatccacgtggtg
ccggaggaccgcgtggcgcaggcgtccaacgcctcgttcgacgcggccacgttcgaaatc
tggggcgcgttgctcaacggcgcgcgggtggtgggcgtgaaccgggagacggcgttgtcg
ccccgggcgttcgcgtcgtggctgcgcgaggagggcatccgggtcctcttcctcaccacg
gcctggttcaaccaggtggccgccgaggtgccggacgccttcggtggggtgcggcagctc
cacttcggcggtgaggccgtggacccccggccggtgcgccaggtcctgcgcgcggggccg
cccgggcggctgctccatgtctatgggcccacggagaacaccacgttctccacgtggcac
cacgtcacggacgtgccggagggcgccacctccatccccattggcaggccgctggcgaac
accgtccagtacgtgctcggcgtggacctggcgccggtgccgcctgggggtgtgggggag
ctgtggctcggaggggatggcctggcgtggggctacctgggacagcccgcgttgacggcg
gagcgcttcgttccggacccgttcagcacgcgtcccggggcgcggctctaccggacgggg
gaccgggtccgcttgctcgcggacggcgcggtgacgttcgagggccgcgtggacgcgcag
gtgaaggtgcgcggcttccgcgtggagccgggcgaggtcgaggccgcgctgcttcgtcac
cccgatgtccggcaggccgtggtgctggcgcgggaggatgacgcagggggctcgcggcgc
ctggtggcctatgtcgtcacggcggcggagcgctccgcgacgcccgcggtgctgcgcgcc
ttcctggccgcgcacctgccggcgtacatggtgccggcggtcatcatgccgctggagcgc
ctgccgctgacgcccaacgggaaggtggaccgcaaggcgctgccggcgccgcgggtcgag
tcggatgtccccacgtcgctggggcccgaggaggcgcgggtcgccagcctctttggcgag
ctgctcggcgtcgcccgcgtcggggcggcggacagcttcttcgacctgggcgggcactcg
ctgctggccacgcgggtcgtcacgcggcttcaggcgtccttcggcgtcgtcctgacgctg
cgggagctcttcgactcaccgaccgtggcggggctggccgagcgcatccggcaggtccgc
cggtcttccggtccggagcgcccgccgcccatcatccccgtctccagggacgcgccgctg
ccgctgtccgcgatgcaggagcgcctgtggctgctggaacagctccagcccggcacggcg
ctctacaacgtcccctgggccgcgtggctcaccggaccgctggacgtgcctgccctggag
cgggcgctcgcggggctgttcctccgtcacgaggcgctgaggaccaccttcgccagcaac
gcgggggagcccgtgcaggtcatccacccgagcgccggcgtcgcgctcccggtcgtggac
ctgggcgcgttgccggaggcggagcgggaggcgcaggcgctgcacgtcgcttcggaagaa
gcgcgccggccgttcgacctgtccaacgggccgttgtgccgggcgttgctcatccggacg
gcgtcggaggcgcacctgctggtcctcacgctgcatcacatcatctccgacgggtggtcc
ctgggggtggccgtgcgggagctgtcggcgctgtacggggcggagctgcggggccgaccc
gcggcgctgccagcgcccacgctccagcccgcggaccacgcggtgtggcagcgtgagtgg
ctccagggagaggcgctctccgcgcagctcggctactggcgcgagcagctcgctggagcg
ccccccgtcctggagctccccaaggacttcccccggccgggcctgcaacgcttccggggc
gacaccctgtccgtgcagctccccgccgggctgtccgagtccttccgtgcgctgtgcggg
cgcgaaggcgtcacgcccttcatgggcctgctggccgccttccagctcctgctgtcgcgc
gtgtcggggcaggaggacgtgtgcgtgggggcgcccatcgcgggccggcagcagcccggg
ctggaggacctgatcggcttcttcgtcaacacgctggtgttgcgcgcgcgcctgccgcgg
tcgctgtccttccgtgagctgctgcgccaggtgcgggagacgacgctggaggcctacgcc
catcaggacgtcccgttcgagaagctggtggaggcgctgcagccgcctcgcagcctgagc
cacgcgccgctggtgcaggtggtgctcgcgctccacgagcccgcgcgcccggacgcggcg
cccgaggggctcaccctgcgccccgtggagctggcctcgggcacgtcgaagttcgacctc
acgctgtccctggtcgacgccccggagggcttcaccggcacgctggagtacgacgcggac
ctcttcacccgggagacggccgcgcggctgatgcaggcgctccgggtgttgctggagagc
gcggtggccgacgcgggccagcggcgctgccgatga

DBGET integrated database retrieval system