KEGG   Myxococcus fulvus: LILAB_32090Help
Entry
LILAB_32090       CDS       T01558                                 

Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mfu  Myxococcus fulvus
Brite
Enzymes [BR:mfu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LILAB_32090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEI68299
UniProt: F8C9M0
LinkDB All DBs
Position
complement(7895018..7895599)
Genome map
AA seq 193 aa AA seqDB search
MPFTLPELPYAKDALQPHMSAETLEFHHDKHHAAYVNNLNKLLDGKPEANKSLEEVILSS
DGGVFNNAAQVWNHTFFWQCMKPAGGGKPTGELAAAIDRDFGSFDKFKEEFSTAAATQFG
SGWAWLVLEGGKLKVTKTGNADLPMKHGQKALLTIDVWEHAYYIDYRNARPKFIETFLNN
LVNWDFVAQNFKG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcacgttgcctgaactgccgtacgcgaaggacgccctccagccgcacatgagc
gcggagacgctcgagttccaccacgacaagcaccacgccgcctacgtcaacaacctgaac
aagctcctggacggcaagccggaggcgaacaagtcgctggaggaggtcatcctcagcagc
gacggtggcgtgttcaacaacgccgcgcaggtgtggaaccacaccttcttctggcagtgc
atgaagcccgctggcggcggcaagccgacgggcgagctcgcggcggccatcgaccgtgac
ttcggctccttcgacaagttcaaggaggagttctccaccgccgcggccacgcagttcggc
tcgggctgggcctggctggtgctggagggcggcaagctcaaggtcaccaagacgggcaac
gcggacctgccgatgaagcacggccagaaggccctgctgaccatcgacgtgtgggagcac
gcgtactacatcgactaccgcaacgcgcgtcccaagttcatcgagacgttcctcaacaac
ctggtgaactgggacttcgtggcccagaacttcaagggctag

DBGET integrated database retrieval system