KEGG   Myxococcus fulvus: LILAB_36190Help
Entry
LILAB_36190       CDS       T01558                                 

Definition
(GenBank) group 2 glycosyl transferase
Organism
mfu  Myxococcus fulvus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21 Glyco_tranf_2_2 Cellulose_synt
Motif
Other DBs
NCBI-ProteinID: AEI69115
UniProt: F8CND1
LinkDB All DBs
Position
complement(8877841..8879364)
Genome map
AA seq 507 aa AA seqDB search
MTTVEIIFLGVYFSLLCVLGVYGSHRYRMAFLYYRHKFKLPTPKGALTTLPKVTIQLPIF
NEMYVVERLVESVCRIDYPRDLLEIQVLDDSTDETCGIARACVERMRQRGHDIVYIHRVN
RQGFKAGALENGLKLAKGQFVAVFDADFVPSPDFLTRTVPFFSDDKVGMVQVRWGHLNRE
FSLLTQAQSIFLDGHFIIEHTARNRAGCFFNFNGTAGIWRRDTISDAGGWQHDTLTEDLD
LSYRAQLKGWQFVFLPEVISPAEVPVDMNAFKSQQHRWAKGSIQTAKKLLPTILKSDLPL
VVKREAFFHLTNNMAYLLMVLLSVLMPISMVVRFQHGLYGTLFLDLPFFLTATASVCFFY
VAAQRERGAKGWERVKYLPFLMSLGIGMAISNAKAVAEALLNQQSGFARTPKTGAEGKKA
VVVKKAYRGSKSLLPLVELLFAAYFTGALWFAIDARIYTSVPFIVLFLAGFLYVGSSSLL
QGLSGRLKLAESAPTVETPDEQPRQAA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgtcgagatcatcttcctgggcgtctatttcagcctcttgtgcgtgctggga
gtctacggctcgcacaggtaccggatggcgttcctgtactaccggcacaagttcaagctg
ccgacgccgaagggtgcgctcacgacgctgcccaaggtcaccatccagctccccatcttc
aacgagatgtacgtggtggagcgcctggtggagtcggtgtgccgcatcgactacccgcgc
gacctgctggaaatccaggtgctggacgactcgacggatgagacgtgtggcatcgcccgg
gcgtgcgtggagcgcatgcgccagcgggggcacgacatcgtctacatccaccgcgtcaac
cgccagggcttcaaggcgggcgcgctggagaacggcctgaagctggcgaagggccagttc
gtggccgtgttcgacgcggacttcgtgcccagccccgacttcctgacgcgcaccgtgccg
ttcttctcggacgacaaggtgggcatggtgcaggtgcgctggggccacctgaaccgcgag
ttctcgctgctgacgcaggcccagagcatcttcctggacgggcacttcatcatcgagcac
accgcgcgcaaccgcgccggctgcttcttcaacttcaacggcaccgcgggcatctggcgc
cgtgacaccatctccgacgcgggcggctggcagcacgacacgctcacggaggacctggac
ctgagctaccgcgcccagctcaagggctggcagttcgtgttcctgcccgaggtcatctcc
ccggccgaggtgccggtggacatgaacgccttcaagagccagcagcaccgctgggccaag
ggctccatccagacggcgaagaagctgctgcccaccatcctcaagagcgacctgccgctg
gtggtgaagcgcgaggccttcttccacctcaccaacaacatggcgtacctgttgatggtg
ctgctgtcggtgctgatgcccatcagcatggtggtgcgcttccagcacggcctctacggc
acgctgttcctggacctgcccttcttcctcacggccaccgccagcgtctgcttcttctac
gtggcggcgcagcgggagcgcggcgccaaggggtgggagcgggtgaagtacctgcccttc
ctcatgagcctgggcatcggcatggccatcagcaacgccaaggcggtggccgaggcgctg
ctcaaccagcagtcgggcttcgcgcgcacgccgaagacgggcgccgagggcaagaaggcc
gtcgtcgtcaagaaggcgtaccggggcagcaagtcgctgctgccgctggtggagctgctc
ttcgcggcgtacttcaccggcgcgctgtggttcgccatcgacgcgcgcatctacacgtcg
gtgcccttcatcgtcctgttcctggcgggcttcctctacgtgggcagctccagcctgctc
cagggcctgtccggccggctgaagctggcggagtccgcccccacggtggagacccccgac
gagcagccccgccaggcggcctga

DBGET integrated database retrieval system