KEGG   Myxococcus fulvus: LILAB_36195Help
Entry
LILAB_36195       CDS       T01558                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mfu  Myxococcus fulvus
Pathway
mfu00473  D-Alanine metabolism
mfu00550  Peptidoglycan biosynthesis
mfu01100  Metabolic pathways
mfu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mfu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LILAB_36195
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LILAB_36195
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LILAB_36195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mfu01011]
    LILAB_36195
Enzymes [BR:mfu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LILAB_36195
Peptidoglycan biosynthesis and degradation proteins [BR:mfu01011]
 Precursor biosynthesis
  Amino acid ligase
   LILAB_36195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEI69116
UniProt: F8CND2
LinkDB All DBs
Position
complement(8879690..8880670)
Genome map
AA seq 326 aa AA seqDB search
MGKRVGVLMGGWGEEREISLKTGEAVVAALESRGHQVTRIFAGPGLDRALRAAELDVAFI
ALHGRMGEDGRVQGLLELLELPYTGSGVLASALAMNKPFAKRLFRLHNLATPQGYTVARE
DAWRALALHGDLGFPCVVKPACGGSSVGLAVVREPEALAPAVAQASRFGGQALVERYVAG
REVTVGILGGEVLGSCEVATPREGFDFDAKYKGGAAYFCPPRLTPTRVANVEALALAAYR
ALGCRGQARVDLLCSDTENDVVLEVNTLPGFTPTSLLPKIAARAGLDFAALTERILALAT
RDEAGVLEAPAVEGAPDLAVPRRAVS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcgcgtgggagtgctgatgggcgggtggggcgaggagcgggagatttcgctc
aagacgggagaggccgtggtggcggcgctcgaatcccggggccatcaggtgacgcgcatc
ttcgcggggccgggcctggaccgggcgctgcgcgcggccgagctggacgtggccttcatc
gcgctccacgggcgcatgggcgaggacggccgggtgcaggggctgctggagctgctggag
ctgccgtacacgggctcgggcgtgctggcgtcggcgctggccatgaacaagcccttcgcc
aagcggctcttccgcctgcacaacctggccacgccccagggctacacggtggcgcgcgag
gacgcgtggcgcgccctggccctgcacggcgacctgggcttcccgtgcgtggtgaagccc
gcgtgcggcggttcatcggtggggctggccgtggtgcgtgagccggaggcgctggcgccc
gcggtggcgcaggcgagccgcttcggcggccaggccttggtggagcgctacgtggcgggc
cgcgaagtcacggtgggcatcctcgggggcgaggtgctggggagctgcgaggtggccacg
ccgcgcgagggcttcgacttcgacgccaagtacaagggcggcgccgcgtacttctgccca
ccccggctgacgcccacgcgtgtggccaacgtggaggccctggcgctggccgcgtaccgc
gcgctgggctgccgcgggcaggcgcgggtggacctgctgtgctcggacacggagaacgac
gtggtgctggaggtgaacacgctgccaggcttcacccccaccagcctgctgccgaaaatc
gccgcccgggccggtctggacttcgccgcgttgacggagcgcatcctggcgctcgccacc
cgcgacgaggccggcgtgctggaggcccccgcggtggagggcgcgccggacctggccgtg
ccccgccgcgcggtgagctga

DBGET integrated database retrieval system