KEGG   Methanosarcina flavescens: AOB57_008955
Entry
AOB57_008955      CDS       T05666                                 

Gene name
pylD
Definition
(GenBank) 3-methylornithyl-N6-L-lysine dehydrogenase PylD
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mfz  Methanosarcina flavescens
Pathway
mfz00300  Lysine biosynthesis
mfz01100  Metabolic pathways
mfz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mfz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    AOB57_008955 (pylD)
Enzymes [BR:mfz01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     AOB57_008955 (pylD)
SSDB
Motif
Pfam: NAD_binding_2 UDPG_MGDP_dh_N 3HCDH_N 2-Hacid_dh_C Shikimate_DH
Other DBs
NCBI-ProteinID: AYK15305
UniProt: A0A660HTW5
LinkDB
Position
complement(2007310..2008089)
AA seq 259 aa
MALLTPDDLKDINKQLQEADSIVWKVTGLDIKGVCKALYGTSPNSEKVGIVPVTSGNGII
GNFSASLHAITQYFGFDSFVTNMSDVSGYYEAVRSGADIILMADDHTFLAHNLKNGKIAN
NQPSTGIIYAEIASRNQKTDSKDVLVVGLGKVGFPGAVHLVHKGFRVYGYDTDRTLLKRA
VSSLGIIPLDIESPKKFSTIFEATPCANTIPETLISKNCVLSTPGIPCAISEELRLKYDV
QLVMEPLGIGTASMLYSVL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcactcttaaccccagacgatctgaaagatattaacaaacaacttcaggaagctgat
tctattgtatggaaagtaaccgggcttgacataaaaggcgtctgcaaagctctttacggc
acctctccgaattctgagaaagtcggtatcgtgcctgtaacttcaggaaatggcataata
ggaaatttttcagcttccctgcatgcaattacgcagtacttcggatttgacagttttgtt
acgaatatgtcggatgttagcggctattatgaagccgttcgaagtggagccgatattatc
ctgatggcagatgaccacacctttcttgcgcataacctcaaaaacggaaaaatagccaac
aaccagccctccacaggcataatctatgctgaaatcgcctccaggaatcaaaaaaccgat
tcaaaggatgtactggttgtggggcttgggaaggtaggttttcccggagcagtacacctt
gtacacaaaggtttcagggtatatgggtatgatactgatagaaccctcctgaaacgagcg
gtttcaagccttggaattattcctctcgacattgaaagcccaaaaaagttttccactatt
tttgaagcgaccccatgtgcaaacacgattcctgaaactttaatctcaaaaaattgtgtg
ctttccacccctggaattccctgtgcaatctcagaggagcttcgactgaaatacgatgtg
caacttgtaatggagcccctgggaataggaactgcatcgatgttgtattctgtgttgtga

DBGET integrated database retrieval system