KEGG   Methanosarcina flavescens: AOB57_009685Help
Entry
AOB57_009685      CDS       T05666                                 

Definition
(GenBank) radical SAM protein
Organism
mfz  Methanosarcina flavescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_12 Fer4_14 SPASM B12-binding
Motif
Other DBs
NCBI-ProteinID: AYK15424
LinkDB All DBs
Position
complement(2179841..2180983)
Genome map
AA seq 380 aa AA seqDB search
MRKEESKNSGALSPFLPPPILKGYMYGAQEAREARNSNRLLAIRLETNKSCNLRCRYCYA
QSGEDSAKIADFSSLKQIVSAAKELGIRSVVVIGGGEPTLHPNFRDLVAYIDSLGLISVI
FSNTVLITEELAGFLHEHNVSVMGKLDSLKPEVQDYLAGKEGASEKIRKGLENLLKAGFS
KPAGPGELRLGVSFVSNKMNLGEIEEIWHFCRQNNIFPNMEILTPTGRANNELEDKLLTA
DEIKEYKLKLLEIDRKYYGYDWLPYTPITASGCLQHLYSLYINIEGNVRPCAPTKLDVHP
ALRVDGEYPYNINKMSLREIYYSDLFTYVRNIDKVLEGRCRNCEHMEECIGCRGYAYSIG
VNNGADPLEALRMECQQCFK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaggaagaatcgaagaactctggcgcattaagtccttttttaccgcctccgata
ttgaagggctatatgtatggggcgcaggaggcccgtgaggctcgtaactcaaatagactt
ttagccatacgccttgaaacgaacaaatcatgtaaccttcgctgccgctactgctatgca
cagagtggagaggattcggcaaaaatagcagatttcagttccctcaaacagatagtttcg
gcagcaaaagaactggggatcaggtccgtggtcgtgataggagggggagaaccgacactg
catccgaatttcagagatctggttgcttatattgattccctgggattaatctctgtaatt
ttctcgaatactgttttaataactgaggaacttgcaggattcctgcacgaacacaacgtc
tcagtaatgggaaagctggattcccttaagcctgaagttcaggattatctggcagggaaa
gaaggagcctcagaaaagatcagaaaagggcttgaaaaccttcttaaagcaggcttttca
aagccggcagggcctggggagctccgcctgggagtttctttcgtcagtaataaaatgaat
ctgggagagatagaagagatctggcatttctgcaggcaaaacaatatcttccccaatatg
gagattctaacgccgacaggcagggcaaataatgaactcgaggataagctgctgacagct
gacgagataaaggaatataagttaaaactgctggaaattgaccgtaagtattacgggtac
gactggctgccctacacaccgattactgcgagcggttgccttcagcatctttacagcctg
tatatcaacatagaagggaatgtccggccctgtgcgcctacaaagcttgatgtacatcct
gcgctcagagttgacggggaatatccctacaatataaacaaaatgagccttcgggagatt
tattattctgatctcttcacatatgtccgaaacatcgataaagtgcttgagggaagatgc
aggaactgtgaacatatggaagagtgcataggctgccggggatatgcctacagcatagga
gtaaacaatggtgccgaccctctcgaagccctgagaatggagtgccagcagtgtttcaaa
taa

DBGET integrated database retrieval system