KEGG   Methanosarcina flavescens: AOB57_010020Help
Entry
AOB57_010020      CDS       T05666                                 

Definition
(GenBank) DNA polymerase elongation subunit
  KO
K02319  DNA polymerase, archaea type [EC:2.7.7.7]
Organism
mfz  Methanosarcina flavescens
Pathway
mfz03030  DNA replication
Brite
KEGG Orthology (KO) [BR:mfz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOB57_010020
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mfz03032]
    AOB57_010020
Enzymes [BR:mfz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AOB57_010020
DNA replication proteins [BR:mfz03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    B-family DNA polymerases
     AOB57_010020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_exo2
Motif
Other DBs
NCBI-ProteinID: AYK15480
LinkDB All DBs
Position
2265481..2268279
Genome map
AA seq 932 aa AA seqDB search
MPMDFQILDADYEVINDSNPVIRLFGRGADGKSVCCFVPDFEPYFYLKASGDLHAVARLI
KDTFAQVKKVEIVEKFEPIGYQKTKKEMLRVTTHLPRDVPEIRGDILKLQEVMRAEGKWE
VYETDILFRNRFLIDKNLGGMVWLSAEGDPIDPVKYFRRSTSGSSRCENFACDSSILASG
FKKVENFTIAPLKYLSFDIECLPLDGGMPSPDVSPIVMISFSFEPEYRGHKTLVLLARPA
EGINSDVLPCKDETEMLNRFFEIFCEYDPDIVAGYNHQDFDIPYITDRVRALVAQGKAIN
PVVGRDGSKISYRRFGLLTRTEMKGRVVVDALPLVRRAFSLKQYTLRAVSKELLNREKLD
VPPLEMEEYWFDTGEKFRKFVDYARRDAELALELILNLRLLDKYIALAQVSGSLLQEIVD
GGQTSMVETLLLREFGLRDRVLLPKPDDGVSAERYEMSSDLKGGEVLEPKKGLLENVLLL
DYKSLYPTIMMAHNLCYSTVVTGDTPDGATIKPPSGGEFVPPDVYKGIVPSILEDLLNQR
SLTKQRMRSTSDENEYRVLDATQLAVKILLNSFYGYSGYARARLYNLTLANAVTSFGRSN
ILNTREIINNTIRKIVLRSGAALLLDEAGELSPHDKVVELSVAYGDTDSVFVHCQSTMDL
SLEEVSLVGNRLSDIVSASLPDPMELEFESIAKRALLIAKKRYALWLFEPRNSGWEDKIK
VKGMETVRRDWCELTSVTLNRVLELVLIEGNVDRAVEHVRKVVNNVRNLDPAKDSEIIES
LILTRTLTRKSESYKNKQPHLTVAEKLKERTGVMPSIGTRIPFVITAGKGLFVDRAEDPD
YVREHNIPIDVDYYIKKQILPPVERILEVFGVKLSSLDFDSKQKGLFDFEAKKPEVKKQE
KPRPKKENNEKPKEQNLFKENGRAEQSSLFDF
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgcctatggatttccagatcttggatgcagattatgaagttattaatgacagcaacccc
gtcatccgcctctttggcagaggggcggacgggaagagcgtttgctgttttgtacctgat
tttgagccttatttttatctcaaggcttctggagaccttcacgccgtagccaggcttatc
aaagatacttttgctcaagttaaaaaagtcgagattgttgaaaaattcgagcccattggg
tatcagaaaacaaaaaaagagatgctcagagtcaccacccaccttcccagagacgtgccc
gagataaggggcgatatcctcaagctccaggaagtgatgcgggctgagggcaaatgggaa
gtctatgaaactgacattctcttcagaaatcgttttttaatcgataagaaccttggaggt
atggtctggttatccgcagaaggagacccgattgaccctgtaaaatatttccgtagaagc
acctcaggcagctcccgctgcgaaaatttcgcatgtgattcttcaatccttgcatccggg
tttaaaaaggttgaaaactttacaattgcccctctgaagtatctttcttttgacatagag
tgtctgcctcttgatggtggaatgccttccccggatgtttcacctatagttatgatcagt
ttctccttcgagccagaatacagagggcataaaacgcttgtgcttctggcaagacctgcg
gaaggcataaattctgatgttcttccctgcaaagacgaaactgagatgctaaatcgattt
ttcgaaatcttctgcgaatacgaccctgatattgtagcaggctataaccatcaggatttc
gatattccttacataacggacagagtccgggctctggttgcacaggggaaagcaataaat
cctgttgtcggcagagatggcagcaaaataagctacaggcgattcgggcttctcacccgt
actgaaatgaaaggccgcgtggttgttgatgcgcttcctcttgtaagaagagctttcagt
ctcaagcaatacaccctgcgtgcggtctcaaaggaacttttgaaccgtgaaaagctggac
gtaccccctcttgagatggaagaatactggtttgatacaggggaaaaattcagaaaattc
gtcgattatgcacgcagggatgccgaactggctctcgaacttatccttaatttgaggctc
cttgacaagtatatagctcttgcccaggtaagcggaagcctgcttcaggaaatcgttgat
ggcggtcagacttcgatggttgagaccctgcttctcagagagttcgggctccgcgaccgt
gttctcctccccaaacccgatgatggggtttcggctgagcgttatgaaatgagttccgac
cttaaaggcggagaagtcctggaacccaaaaaaggacttctggaaaatgtgcttcttctt
gactacaagtccctttacccaactataatgatggcgcataacctgtgttatagtacagta
gttacaggtgacacacctgatggggcaactatcaaacctccatcaggaggggagttcgtg
cctcctgacgtttacaaaggcatcgtgccttctatccttgaggatctgcttaaccagaga
tcgctgacaaagcaaagaatgagaagtacttctgatgaaaacgagtatcgagtacttgat
gctactcaactcgccgtaaaaattctactaaatagcttttacggttattccggatatgcc
cgggcaaggctctacaacttgacgcttgcaaacgctgtaaccagtttcggcagaagcaat
atcctgaacacccgggaaattatcaacaacactataagaaaaatcgtgctcaggagtgga
gcagctctactccttgacgaagctggagaactctctcctcatgataaggtagttgagttg
tcggttgcctacggagatacggatagtgtttttgtccactgtcaatccacaatggatctc
tcgcttgaggaggttagccttgtaggtaacaggctttcagatatcgtttctgcttccctg
cctgacccaatggagcttgagtttgaatccattgcgaaacgtgctctccttatagcaaag
aaacgctatgctctctggctctttgaacccaggaactctggttgggaagataagattaag
gtcaaaggcatggaaacagtccgaagagactggtgcgaactgacctcggtaaccctcaac
agggttcttgagcttgtgcttatagaaggtaatgtcgaccgggctgtagagcatgtccgc
aaggtggttaacaatgtcaggaaccttgaccctgcaaaagactccgagattatcgaaagc
cttattctcacacgcacccttacccggaaatcggagagttacaagaacaagcagcctcac
cttacagtcgcggagaagctgaaggaacggaccggtgtcatgccttcgataggaaccagg
ataccttttgtcattactgccggaaaagggctatttgtagatagggctgaagacccggac
tatgtcagggaacacaatatcccgatagatgtcgattactatattaagaaacagatactc
ccccctgtagaacgtatcctggaagttttcggggttaagctttcttcacttgactttgat
tccaagcaaaaaggactatttgactttgaagctaagaaacctgaagtaaagaagcaggaa
aagcctcgtcccaaaaaggaaaataatgagaagcctaaggagcaaaatttatttaaggag
aatgggcgtgcagaacagagctcccttttcgatttttga

DBGET integrated database retrieval system