KEGG   Mycoplasma gallisepticum F: MGF_0751Help
Entry
MGF_0751          CDS       T01924                                 

Definition
(GenBank) putative ABC-type transport system protein
  KO
K01992  ABC-2 type transport system permease protein
Organism
mgf  Mycoplasma gallisepticum F
Module
mgf_M00254  ABC-2 type transport system
Brite
Transporters [BR:mgf02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    MGF_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_5
Motif
Other DBs
NCBI-ProteinID: ADC31049
LinkDB All DBs
Position
125739..126755
Genome map
AA seq 338 aa AA seqDB search
MIDIFNFKNQNIFNTFQSNYTTNLDNYLYYNKLDAPTYSYQLNENNVLPRYLVNIRDDKT
PNYQDVYLVPGALKNNLNPSLDELNNTKIIYARQDADNFDITFPEDEFNNTNASDIVGKL
NWTYIKELLDSKVFNAYSKQFIDNLIKSDGYINGDPSDLTYYHNLLMSEIQNEITDEQSK
FNNLDDNITVLEDSSITNKIIKSNIERQIYLTVALVYYIYFNQNNDLLTTALLFNNKLDD
NSNNFTPKQLSFNYGTYTYHIGGYANYSTKQEVQNNKVIIRYDLKKSNNFVFQPVTQIMQ
MTRNEEIINKYLFILLWAVIASLFVVANNILYIRKDYK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgattgatatctttaactttaaaaaccaaaatatttttaatacatttcaaagcaactat
actactaatttagataactacctatattataacaagctagatgcaccaacatattcttat
caattaaatgagaataacgttttaccaagatatttagtcaatatacgtgacgacaaaaca
cctaattatcaagatgtttatttagttccaggagccttaaaaaataatttaaatccaagt
ttagacgaactaaataacactaaaattatctatgcgcgacaggatgctgataattttgat
attacttttcctgaagatgaatttaataatactaatgctagtgatattgtcggcaaattg
aactgaacttatattaaagaattattagattcaaaagtatttaatgcttattctaaacaa
tttattgataatttaattaagtctgatggttatataaacggggatcctagtgatttaact
tattatcacaatcttcttatgagtgagattcaaaatgaaattactgatgaacaatctaag
tttaacaatttggatgataatataaccgttttagaggattcatcaattaccaacaaaata
attaaatctaatattgaaagacagatctatttaactgttgctttagtttattacatttac
tttaatcaaaataacgatctattaacaactgctttattatttaataataagctagatgat
aattcaaataactttacaccaaaacaattaagttttaattatggtacttatacttaccat
attggtggatatgcaaattactcaactaaacaagaagtgcaaaataataaagttatcatt
cgttacgacttgaaaaaatctaataattttgtttttcaacctgtgacacaaattatgcaa
atgacgcgtaacgaagagattattaataaatacttattcattttactatgagctgtgatt
gcatcattatttgtagtagcaaacaatatcttatacattagaaaggattacaaataa

DBGET integrated database retrieval system