KEGG   Micropruina glycogenica: MPLG2_1523Help
Entry
MPLG2_1523        CDS       T05338                                 

Gene name
ligC
Definition
(GenBank) DNA ligase C
Organism
mgg  Micropruina glycogenica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: SPD86559
UniProt: A0A2N9JGA0
LinkDB All DBs
Position
1:complement(1511490..1512566)
Genome map
AA seq 358 aa AA seqDB search
MAPMQLPVMPPVKPMLAKLVPTIPTGELSYEPKWDGFRSIVFRDGDEVEIGSRNERPLTR
YFPELVEAVKANLPERCVVDGEIIVVVGDRLQFEVLSQRIHPAASRITMLSAQTPASFVA
FDLLALGDDDLTSRPFEQRRAALEQALTDAAAPVHLTPATRDPELAQQWFSQFEGAGLDG
VVAKPLVGTYQPDKRTMFKIKHQRTADCVVAGYRVHASGPDAIGSLLLGLYNDEGELASV
GVIGAFPAARRKELFTELQPLVTTFDDHPWAWAKQEQGTRTPQNSAGSRWNNGKDLSFTP
LRPELVVEVRYEHMEGVRFRHTAQFNRWRPDRDPRSCTYEQLDEPVSYDLAEILALKS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcacccatgcagttgcccgtgatgccccccgtcaagccgatgctggccaagttggtg
cccaccattcccaccggcgaactcagttatgagcccaaatgggacggctttcgctcgatc
gtctttcgcgacggtgacgaggtagagatcgggtcacgcaacgagcgtccgctgacccgg
tacttccccgaactcgtcgaggcggtgaaggccaacctgcccgagcgttgcgtcgtcgac
ggcgagatcatcgtcgtggtcggcgatcggctgcagttcgaggtgctctcgcagcgcatt
catcccgcggccagccgcatcaccatgctgagcgcgcagaccccggccagcttcgtcgcc
ttcgacctgctcgcgctgggcgacgacgaccttacttcgcgacccttcgaacagcgccgt
gccgcacttgaacaggcgctgaccgacgcggccgcaccggtgcacctcaccccggccacc
cgcgaccccgagctggcgcagcagtggttcagccagttcgagggggcgggtctcgacggc
gtggtggccaagccgctggtcggcacctatcagcccgacaagcgcaccatgttcaagatc
aagcaccagcgcacggccgactgcgtggtggccggctaccgggtgcacgccagcgggccg
gacgcgatcggctcgctgctgctcggcctctacaacgacgagggcgagcttgcctcggtg
ggggtgatcggggcgtttccggcggcccggcgcaaggagttgttcaccgagttgcagccg
ctggtcaccaccttcgacgaccacccgtgggcgtgggcgaagcaagagcaaggcacgcgc
accccgcagaactccgcgggcagccgctggaacaacggcaaagacctgtcgttcaccccg
ttgcggcccgaactggtggtcgaggtgcgctacgagcacatggagggcgtccggttcagg
cacaccgcccagttcaaccgctggcggcccgaccgcgacccacgctcgtgcacctacgag
cagctggacgagccggtgagctacgacctggccgaaattctggcgctgaagtcttga

DBGET integrated database retrieval system