KEGG   Micropruina glycogenica: MPLG2_2007Help
Entry
MPLG2_2007        CDS       T05338                                 

Gene name
inhA
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mgg  Micropruina glycogenica
Pathway
mgg00061  Fatty acid biosynthesis
mgg00780  Biotin metabolism
mgg01100  Metabolic pathways
mgg01130  Biosynthesis of antibiotics
mgg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mgg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MPLG2_2007 (inhA)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    MPLG2_2007 (inhA)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    MPLG2_2007 (inhA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mgg01004]
    MPLG2_2007 (inhA)
Enzymes [BR:mgg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     MPLG2_2007 (inhA)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     MPLG2_2007 (inhA)
Lipid biosynthesis proteins [BR:mgg01004]
 Fatty acid synthase
  Component type
   MPLG2_2007 (inhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR SbcD_C
Motif
Other DBs
NCBI-ProteinID: SPD87037
UniProt: A0A2N9JHX2
LinkDB All DBs
Position
1:complement(1943361..1944131)
Genome map
AA seq 256 aa AA seqDB search
MRILEGKSVLVAGVTMNTSIGYRIAELAAEQGATVLVSNFGRALSLTRRIIKRLDPEPVL
LEVDVTNEEHLAGLADQLRQHVDHLDGVVHSIAFANPETAMGGKFLTTPADDVKTAIHVS
AYSLVSLTMACRPLMGPGGSIVGLTFDARQSWPVYDWMGVAKSALESTSRYLARYLGPDG
IRSNIVAAGPLETIAKKAIPGSEEFNNIWGRRAPLGWDPKDLDPTAKAVVALLSDWFPST
TGEMLHVDGGLHSTGA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattctcgaaggcaaaagcgttctggtcgccggcgtgaccatgaacacctcgatc
ggctaccgcatcgcggagctggccgccgagcagggcgccaccgtgctggtgtcgaacttc
ggccgcgcgctcagcctcacccggcgcatcatcaagcggctcgaccccgagccggtgctg
ctcgaggtcgacgtcaccaacgaagagcacctggccgggctggccgatcagttgcgccag
cacgtcgaccatctcgacggcgtggtgcactcgatcgcgttcgccaaccccgagacggcc
atgggcggcaagtttctgaccacgcccgccgacgacgtgaagaccgccattcacgtgtcg
gcctactcgctggtgtcgctcaccatggcgtgccgtccgctgatggggccgggcggctcg
atcgtcgggctcacgttcgacgcccggcagtcgtggccggtctacgactggatgggggtg
gccaagtcggcgctcgaaagcacctcgcgctacctggcccgctacctcggccccgacggc
attcgcagcaacatcgtggccgccggccccctcgaaaccatcgccaagaaggccattccc
ggctcggaggagttcaacaacatctggggacggcgggcgccgctgggctgggacccgaag
gatctcgaccccaccgccaaggccgtggtggcgctgctgtcggactggttcccgtccacg
accggtgaaatgctgcacgtggacggcggcctgcattccacgggtgcctga

DBGET integrated database retrieval system