KEGG   Micropruina glycogenica: MPLG2_2474Help
Entry
MPLG2_2474        CDS       T05338                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgg  Micropruina glycogenica
Pathway
mgg00010  Glycolysis / Gluconeogenesis
mgg00030  Pentose phosphate pathway
mgg00051  Fructose and mannose metabolism
mgg00052  Galactose metabolism
mgg00680  Methane metabolism
mgg01100  Metabolic pathways
mgg01110  Biosynthesis of secondary metabolites
mgg01120  Microbial metabolism in diverse environments
mgg01130  Biosynthesis of antibiotics
mgg01200  Carbon metabolism
mgg01230  Biosynthesis of amino acids
mgg03018  RNA degradation
Module
mgg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mgg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPLG2_2474
   00030 Pentose phosphate pathway
    MPLG2_2474
   00051 Fructose and mannose metabolism
    MPLG2_2474
   00052 Galactose metabolism
    MPLG2_2474
  09102 Energy metabolism
   00680 Methane metabolism
    MPLG2_2474
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    MPLG2_2474
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mgg01009]
    MPLG2_2474
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mgg03019]
    MPLG2_2474
Enzymes [BR:mgg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MPLG2_2474
Protein phosphatases and associated proteins [BR:mgg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MPLG2_2474
Messenger RNA biogenesis [BR:mgg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MPLG2_2474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: SPD87504
UniProt: A0A2N9JHE3
LinkDB All DBs
Position
1:complement(2404625..2406856)
Genome map
AA seq 743 aa AA seqDB search
MTEQIGAGKRIGILTSGGDAQGMNAAVRAVVRTAISLGAEVYAVFEGYQGMIDGGAGIRR
FGWDDVGNVLHRGGTVIGTFRSKDFRERAGRRAAARNLLANGIDRLVVIGGDGSLSGLDL
FRTEWPDLLAELVEAGELDQEVADAHPALMIAGLVGSIDNDLVGTDMTIGADSALHRIVD
AIDDLASTAASHQRSFVVEVMGRHCGYLALMAAVAGGCDYVLIPEDPPEAGWEERMCAEL
ARGRAAGRRDSIVVVAEGATDREGNAITSEQVRQIIEQRLGEDTRVTILGHVQRGGRPSA
FDRWCSTWLGYEAVRALLAADPGSEGHVFGIRGNRVAAVPLMDAVRNTREVSHLIDAGDY
TAAMAARGQSFGVMAQLLRELTEPSRITVNEAGKRIGIMHAGGLAPGMNTAARAAVRLGI
SRGHTMLGVRDGFPGLRDGRITELAWADVEAWTADGGANLGLRRTIPGIEELYPIGRQLE
NHQVDALLMIGGWNGYQAMYRLHDERDRYPAFRIPLMCVPASIDNNLPGSELAIGADTAL
NVIVEAIDRIKQSAAATRRSFVVETMGRYCGYLALMGGLAGGSERVYLHEEGITLAQLNR
DIEWLRRSFARGRSLFLAVRNERANEEYTTDVIARMLRAESGGVYDVRQSVLGHQQQGGS
PSPFDRLMATRLVGHALDKIAEQLDAGADGSYLVGLTGSRVKDVPMGDMMSLMNTTVRRP
HDQWWLRLREVVTAVSDEPEPQS
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacagatcggtgccggcaagcgcatcggcattctgaccagcggcggtgacgca
cagggtatgaacgcggcggtgcgggcggtggttcgcacggcgatcagcctgggggccgag
gtgtacgccgttttcgagggctaccagggcatgatcgacggcggtgccggcattcgccgg
ttcggctgggacgacgtcggcaacgtgctgcaccggggcggcaccgtgatcggcaccttt
cgttcgaaggactttcgcgaacgtgcgggacggcgcgccgccgcccgtaacctgctggcc
aacggcatcgaccggttggtggtgatcggcggcgacggcagcctgtcggggctcgacctt
tttcgcaccgagtggcccgacctgctggccgagttggtcgaggcgggtgagctcgaccaa
gaggtcgccgacgcgcacccggcgctgatgatcgccgggctcgtcggctcgatcgacaac
gacctggtcggcaccgacatgaccatcggagccgattcggcgctgcatcgcatcgtggat
gccatcgacgacctggccagcaccgccgccagccaccagcgcagcttcgtggtcgaggtg
atgggccggcactgcggctacctggcgttgatggccgcggtcgccggaggctgcgactac
gtgctgatacccgaggacccgcccgaggccggctgggaggagcgcatgtgcgccgaactg
gcccgtgggcgcgcggccggacggcgtgactcgatcgtggtggtcgccgaaggggccacc
gaccgcgagggcaatgcgatcacgtccgagcaggtgcgccagatcatcgagcaacgtctc
ggcgaagacacccgggtgacgattctcggccacgtgcagcgtgggggacgccccagcgcg
ttcgaccgctggtgctcgacctggctgggctatgaggccgtgcgggcgctgctcgccgcc
gaccccggtagcgaaggccacgtgttcggcattcgcggcaaccgggttgccgccgtcccg
ctgatggacgccgtgcgcaacacccgcgaagtgtcgcacctgatcgacgcgggcgactac
accgcggcgatggcggcgcgcggccaatccttcggggtgatggcgcagctgttacgcgaa
ctcaccgagccgtcacgcatcaccgtgaacgaagccggcaagcgcatcggcatcatgcac
gcgggcggcctggcgcccggcatgaacacggcggcgcgcgcggcggtccggctgggcatc
agccgcggccacaccatgctgggcgttcgggacggctttccgggcctgcgcgacggtcgc
atcacggagttggcttgggctgacgtcgaggcgtggacggctgacggcggcgccaacctg
ggcctgcggcgcaccattccgggcatcgaagagctgtacccgatcggtcggcagctcgag
aaccatcaggtcgacgcattgctgatgatcggtggctggaacggctaccaggccatgtac
cggctgcacgacgagcgcgaccgctacccggcgttccgtattcccctgatgtgcgtaccg
gccagcatcgacaacaacctgcccggctcagagctcgcgatcggcgccgacaccgcactc
aacgtgatcgtcgaggcgatcgaccgcatcaagcagtcggcggccgcgacccggcgcagt
ttcgtggtcgagacgatgggccgctactgcggctacctggcgctgatgggcggcctggcg
ggcggctccgagcgggtctacctgcatgaagagggcatcacgctggctcagctcaaccgt
gacatcgagtggctgcggcggtcgttcgcccgcggccggtcgttgttcctggccgtacgc
aacgagcgggccaacgaggagtacaccaccgacgtgatcgcccgcatgctgcgggccgag
agcggcggcgtctacgacgtgcgccagtcggtactggggcatcagcagcagggcggatca
ccgagccccttcgaccggttgatggcgacccgcctggtgggccatgcgctcgacaagatc
gccgagcaactcgacgccggcgccgacggcagctacctggtcgggctcaccggctcaaga
gtgaaagacgtgccgatgggcgacatgatgagcttgatgaacacgaccgtccggcgtccc
cacgaccagtggtggctgcggctgcgcgaggtcgtgacggccgtgtcggacgaacccgaa
ccccagagctga

DBGET integrated database retrieval system