KEGG   Micropruina glycogenica: MPLG2_2831Help
Entry
MPLG2_2831        CDS       T05338                                 

Gene name
ligD
Definition
(GenBank) Multifunctional non-homologous end joining DNA repair protein LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mgg  Micropruina glycogenica
Pathway
mgg03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mgg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    MPLG2_2831 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgg03400]
    MPLG2_2831 (ligD)
Enzymes [BR:mgg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MPLG2_2831 (ligD)
DNA repair and recombination proteins [BR:mgg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MPLG2_2831 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: SPD87861
UniProt: A0A2N9JJX0
LinkDB All DBs
Position
1:complement(2773577..2776048)
Genome map
AA seq 823 aa AA seqDB search
MSPADQHLDVDGRLIKVTNLDKVLYPETGTTKGDVIAYYQAVAPYFVPHAAHRPATRKRW
PNGVGTPEQPQTPFFHKNLDPKSTPDWVRTFTIEHSEGDNVYPLIDDAATLVWLAQLAAL
ELHVPQWTVLDGERQPPNRLVIDLDPGAGAGIEQCVEVAQLLREVLDQVGFASVPVTSGS
KGIHLYAALGGEMTSDEVSAWAHELALTLEAMRPDLVVSDMNKKLREGRVLLDWSQNNAA
KTTIAPYSLRGRAHPTVAAPRTWDELGPGLRQLEFDEVLERLASMGDPFAAIEFPPVELV
ESPPVELVETPDRLTTYRSMRDPAKTPEPVPADRPEPRPLGNSFVIQEHHARRLHYDFRL
EHDGVLVSWAIPKGPPTDPAVNHLAVQTEDHPLEYGSFEGDIPRGEYGGGHVDIWDAGTF
ELEKWRDGKEVIATLTGRPDGGLGGVPRRFALLHTKMGGDEKNWLIHLMAPADDKSSSRP
APSSSRRTPGSPSSTTTPTESSPAVERDETASAEAPTIAPMLATAGVAQDVQHGDWVFEV
KWDGYRALATVNDGAVRLASRRGHDLTKDFPELAELARLIAPHDAVLDGEVVFLDPDGRP
SFERLQNRAEHRGEAHYMVFDLLRLDGRSQLHEPYTARREQLAALLGDGTRRIQLSTQLG
TDADEALAISRELGLEGVVAKRPDSVYQPGRRVDTWIKIKHLLAQEVVIIGWTPGESARA
RTIGALLMAVPNGDALTYVGRVGSGFTEKDLADTKLVLSEIEVAATTVPDIPAADRKGAH
WVEPILVGEVTYGVWTQAGRLRMPVWRGWRPDKTPDDISLPEQ
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggccgatcagcacctcgacgtcgacggtcgcctgatcaaggtgaccaacctc
gacaaggtgctgtaccccgagacgggcaccaccaagggcgacgtgatcgcgtactaccag
gccgtcgcgccgtacttcgtgccgcacgcggcgcatcgcccggccactcgcaagcgctgg
cccaacggcgtcggcacccctgagcagccgcagacgccgttctttcacaagaacctcgac
cccaagtcgacgcccgactgggtacgcacgttcaccatcgagcactccgagggcgacaac
gtctacccgctgatcgacgacgccgcgaccctggtgtggctggcgcagttggccgcgctc
gaactgcacgtgccgcagtggacggtgctcgacggcgaacggcaaccccccaaccggctg
gtgatcgacctcgacccgggggcgggagcgggcatcgagcagtgcgtcgaggtggcgcag
ttgctgcgcgaggtgctcgatcaggtcgggttcgcctcggtgccggtcaccagcggcagc
aagggcattcacctctacgccgcgctcggcggcgagatgacgtccgacgaggtgtcggcg
tgggcgcacgagctggccctcacgttggaggcgatgcgccccgacctggtggtcagcgac
atgaacaagaagctgcgcgagggtcgggtgctgctcgactggagccagaacaacgccgca
aagaccaccatcgccccctactcgctgcgggggcgcgcgcacccgaccgtggcggccccg
cgcacctgggacgagctggggccgggactgcggcaactggagttcgacgaggtgctggag
cggctcgcatccatgggcgaccccttcgcggcgatcgagttcccgccggtcgagctcgtc
gagtccccgccggtcgagctcgtcgagacccccgaccgcctcaccacctaccgctcgatg
cgcgacccggccaagacccccgaaccggtgccagcggaccgtccggaacctcgtccacta
ggcaattcgttcgtgattcaagagcaccacgcccgccggctgcactacgacttcaggctc
gaacacgacggggtactggtgtcgtgggccatacccaaaggcccaccgaccgacccggcg
gtgaaccatctggcggtgcagaccgaagaccacccgctcgagtacggcagcttcgagggc
gatattccgcgcggcgagtacggcggcgggcacgttgacatctgggacgccggcaccttc
gagctcgagaagtggcgcgacggcaaagaggtgatcgccaccctgaccggacgccccgac
ggcggcttgggcggcgtgccccggcggttcgcgctgctgcacacgaagatgggcggcgac
gagaagaactggctgattcacctgatggcgccggccgatgacaaatcgtcatcccggccc
gccccttcgtcatcccggcgaacgccgggatctccaagctcgaccacgacgccaaccgag
tcgtccccggcggtcgagcgtgacgagaccgcctccgccgaggcccccaccatcgccccc
atgctcgccacggccggcgtcgcgcaagacgtccaacacggcgactgggtgttcgaggtc
aagtgggacggctaccgggctctggctacggtgaacgacggcgcggtgcgactcgccagc
aggcggggccacgacctcaccaaggacttccccgaactcgccgaactcgcccgcctgatc
gctccgcacgacgccgtgctcgacggcgaggtggtgtttctcgacccggacggacggccg
agtttcgagcggctgcagaaccgggccgaacaccgcggcgaggcgcactacatggtgttc
gacctgcttcggctcgacggacgctcgcagctgcacgagccctacaccgccaggcgtgag
caactggccgcactgctcggcgacggcacccgccgcattcaactcagcacccagctcggc
accgacgccgacgaggccctggcgatcagtcgcgaactgggcctcgaaggcgtggtggcc
aagcggcccgacagcgtctatcagccgggccgccgggtggacacctggatcaagatcaag
cacctgctcgcccaagaggtggtgatcatcggctggacgcccggcgagagcgcccgcgcc
cgcaccatcggtgcgctgctgatggcggtgcctaacggcgacgcgctcacctacgtcgga
cgagtcgggtcaggcttcaccgagaaggacctggccgacaccaagctggtgctgtcagag
atcgaggtggctgcgacgacggtgcccgacattccggcggccgatcgcaagggcgcccac
tgggtcgagccgattctggtcggcgaggtcacctacggggtctggacgcaggcgggccgg
ctgcgcatgccggtgtggcgcgggtggcgtccggacaagaccccggacgacatcagcctg
cccgagcagtga

DBGET integrated database retrieval system